BLASTX nr result
ID: Akebia27_contig00016901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00016901 (1106 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56439.1| putative CRM domain-containing protein [Morus not... 57 8e-06 >gb|EXB56439.1| putative CRM domain-containing protein [Morus notabilis] Length = 506 Score = 57.0 bits (136), Expect(2) = 8e-06 Identities = 24/44 (54%), Positives = 36/44 (81%) Frame = -3 Query: 252 HAVSMELEKAFEKVSRELIWWVL*KNGVLNRYIDIIKDVHERVM 121 H V ++LEKA+++V RE++WWVL K GV RYI +IKD+++RV+ Sbjct: 154 HMVFIDLEKAYDRVPREVLWWVLEKRGVHVRYIKVIKDMYDRVV 197 Score = 20.4 bits (41), Expect(2) = 8e-06 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 115 VRKNGREKNKFPGTIY*HQG*ALDPY 38 VR G +FP I +QG AL PY Sbjct: 200 VRTAGGYTAEFPIRIGLNQGSALSPY 225