BLASTX nr result
ID: Akebia27_contig00016852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00016852 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308472.2| RNA recognition motif-containing family prot... 68 1e-09 ref|XP_002322827.2| hypothetical protein POPTR_0016s08010g [Popu... 68 1e-09 emb|CBI28315.3| unnamed protein product [Vitis vinifera] 66 6e-09 ref|XP_002275366.1| PREDICTED: heterogeneous nuclear ribonucleop... 66 6e-09 ref|XP_007205105.1| hypothetical protein PRUPE_ppa004677mg [Prun... 65 8e-09 ref|XP_004506184.1| PREDICTED: nucleolin-like [Cicer arietinum] 65 1e-08 ref|XP_006481757.1| PREDICTED: heterogeneous nuclear ribonucleop... 65 1e-08 ref|XP_006430180.1| hypothetical protein CICLE_v10011562mg [Citr... 65 1e-08 ref|XP_006577079.1| PREDICTED: heterogeneous nuclear ribonucleop... 64 2e-08 ref|XP_006577078.1| PREDICTED: heterogeneous nuclear ribonucleop... 64 2e-08 ref|XP_007201972.1| hypothetical protein PRUPE_ppa004785mg [Prun... 64 2e-08 ref|XP_007027769.1| RNA-binding family protein isoform 7 [Theobr... 64 3e-08 ref|XP_007027766.1| RNA-binding family protein isoform 4 [Theobr... 64 3e-08 ref|XP_007027765.1| RNA-binding family protein isoform 3 [Theobr... 64 3e-08 ref|XP_007027764.1| RNA-binding family protein isoform 2 [Theobr... 64 3e-08 ref|XP_007027763.1| RNA-binding family protein isoform 1 [Theobr... 64 3e-08 emb|CCW28734.1| hypothetical protein ARAX_ADH18B08-005 [Arachis ... 63 5e-08 ref|XP_007015803.1| RNA-binding family protein isoform 2 [Theobr... 63 5e-08 ref|XP_007015802.1| RNA-binding family protein isoform 1 [Theobr... 63 5e-08 ref|XP_006487891.1| PREDICTED: nucleolin-like isoform X1 [Citrus... 62 6e-08 >ref|XP_002308472.2| RNA recognition motif-containing family protein [Populus trichocarpa] gi|550336897|gb|EEE91995.2| RNA recognition motif-containing family protein [Populus trichocarpa] Length = 478 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDS E+KGYAFV FRT+ELA++AIE+LNN EFK K V Sbjct: 134 EIRIMKGKDSSESKGYAFVTFRTKELASKAIEELNNTEFKGKKV 177 >ref|XP_002322827.2| hypothetical protein POPTR_0016s08010g [Populus trichocarpa] gi|550321081|gb|EEF04588.2| hypothetical protein POPTR_0016s08010g [Populus trichocarpa] Length = 485 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDS E+KGYAFV+FRT+ELA++AIE+LNN EFK K V Sbjct: 134 EVRIMKGKDSSESKGYAFVSFRTKELASKAIEELNNTEFKGKKV 177 >emb|CBI28315.3| unnamed protein product [Vitis vinifera] Length = 434 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFK 122 E RIMKGKDSGENKG+AFV FR ELA++AIE+LNN EFK Sbjct: 83 EVRIMKGKDSGENKGFAFVTFRNVELASKAIEELNNTEFK 122 >ref|XP_002275366.1| PREDICTED: heterogeneous nuclear ribonucleoprotein Q-like [Vitis vinifera] Length = 503 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFK 122 E RIMKGKDSGENKG+AFV FR ELA++AIE+LNN EFK Sbjct: 152 EVRIMKGKDSGENKGFAFVTFRNVELASKAIEELNNTEFK 191 >ref|XP_007205105.1| hypothetical protein PRUPE_ppa004677mg [Prunus persica] gi|462400747|gb|EMJ06304.1| hypothetical protein PRUPE_ppa004677mg [Prunus persica] Length = 496 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGENKG+AFV F+ E+A++AIE+LNN EFK K + Sbjct: 144 EVRIMKGKDSGENKGFAFVTFKNVEMASDAIEELNNTEFKGKRI 187 >ref|XP_004506184.1| PREDICTED: nucleolin-like [Cicer arietinum] Length = 450 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 + RIMKGKDS ENKG+AFV FR ELAT+AIE+LNN EFK K + Sbjct: 150 QVRIMKGKDSSENKGFAFVTFRNVELATKAIEELNNTEFKGKKI 193 >ref|XP_006481757.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X1 [Citrus sinensis] gi|568856372|ref|XP_006481758.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X2 [Citrus sinensis] Length = 493 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FRT+ELA++AIE+LN+ E K K + Sbjct: 148 EVRIMKGKDSGEAKGYAFVTFRTKELASQAIEELNSCELKGKKI 191 >ref|XP_006430180.1| hypothetical protein CICLE_v10011562mg [Citrus clementina] gi|567875183|ref|XP_006430181.1| hypothetical protein CICLE_v10011562mg [Citrus clementina] gi|567875185|ref|XP_006430182.1| hypothetical protein CICLE_v10011562mg [Citrus clementina] gi|557532237|gb|ESR43420.1| hypothetical protein CICLE_v10011562mg [Citrus clementina] gi|557532238|gb|ESR43421.1| hypothetical protein CICLE_v10011562mg [Citrus clementina] gi|557532239|gb|ESR43422.1| hypothetical protein CICLE_v10011562mg [Citrus clementina] Length = 493 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FRT+ELA++AIE+LN+ E K K + Sbjct: 148 EVRIMKGKDSGEAKGYAFVTFRTKELASQAIEELNSCELKGKKI 191 >ref|XP_006577079.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X3 [Glycine max] Length = 451 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGK+SGE KGYAFV F T+ELA++AIE+LNN EFK K + Sbjct: 134 EVRIMKGKESGEAKGYAFVTFMTKELASKAIEELNNSEFKGKRI 177 >ref|XP_006577078.1| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X2 [Glycine max] gi|571446385|ref|XP_003520699.2| PREDICTED: heterogeneous nuclear ribonucleoprotein R-like isoform X1 [Glycine max] Length = 467 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGK+SGE KGYAFV F T+ELA++AIE+LNN EFK K + Sbjct: 134 EVRIMKGKESGEAKGYAFVTFMTKELASKAIEELNNSEFKGKRI 177 >ref|XP_007201972.1| hypothetical protein PRUPE_ppa004785mg [Prunus persica] gi|462397503|gb|EMJ03171.1| hypothetical protein PRUPE_ppa004785mg [Prunus persica] Length = 491 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FR +ELA++AIE+LNN E K K + Sbjct: 145 EVRIMKGKDSGEAKGYAFVTFRNKELASKAIEELNNSELKGKRI 188 >ref|XP_007027769.1| RNA-binding family protein isoform 7 [Theobroma cacao] gi|508716374|gb|EOY08271.1| RNA-binding family protein isoform 7 [Theobroma cacao] Length = 369 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FR++ELA++AIE LNN E K K + Sbjct: 128 EVRIMKGKDSGEAKGYAFVTFRSKELASKAIEKLNNYELKGKKI 171 >ref|XP_007027766.1| RNA-binding family protein isoform 4 [Theobroma cacao] gi|590632178|ref|XP_007027768.1| RNA-binding family protein isoform 4 [Theobroma cacao] gi|508716371|gb|EOY08268.1| RNA-binding family protein isoform 4 [Theobroma cacao] gi|508716373|gb|EOY08270.1| RNA-binding family protein isoform 4 [Theobroma cacao] Length = 423 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FR++ELA++AIE LNN E K K + Sbjct: 128 EVRIMKGKDSGEAKGYAFVTFRSKELASKAIEKLNNYELKGKKI 171 >ref|XP_007027765.1| RNA-binding family protein isoform 3 [Theobroma cacao] gi|508716370|gb|EOY08267.1| RNA-binding family protein isoform 3 [Theobroma cacao] Length = 475 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FR++ELA++AIE LNN E K K + Sbjct: 128 EVRIMKGKDSGEAKGYAFVTFRSKELASKAIEKLNNYELKGKKI 171 >ref|XP_007027764.1| RNA-binding family protein isoform 2 [Theobroma cacao] gi|590632174|ref|XP_007027767.1| RNA-binding family protein isoform 2 [Theobroma cacao] gi|508716369|gb|EOY08266.1| RNA-binding family protein isoform 2 [Theobroma cacao] gi|508716372|gb|EOY08269.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 474 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FR++ELA++AIE LNN E K K + Sbjct: 128 EVRIMKGKDSGEAKGYAFVTFRSKELASKAIEKLNNYELKGKKI 171 >ref|XP_007027763.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508716368|gb|EOY08265.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 490 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDSGE KGYAFV FR++ELA++AIE LNN E K K + Sbjct: 128 EVRIMKGKDSGEAKGYAFVTFRSKELASKAIEKLNNYELKGKKI 171 >emb|CCW28734.1| hypothetical protein ARAX_ADH18B08-005 [Arachis duranensis] Length = 1174 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 11/73 (15%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKL-----------VYVKNL 149 E R+MK KD+GEN+GYAFVAF+T+E+A +AIED++N EFK K +++ N+ Sbjct: 827 EVRLMKDKDTGENRGYAFVAFKTKEVAQKAIEDIHNKEFKGKTLRCSLSETKHRLFISNI 886 Query: 150 WEKITQERWRMQI 188 + T++ +R + Sbjct: 887 PKTWTEDEFRKHV 899 >ref|XP_007015803.1| RNA-binding family protein isoform 2 [Theobroma cacao] gi|508786166|gb|EOY33422.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 353 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFK 122 E RIMKGKDS ENKG+AFV FR+ ELA++AI++LNN EFK Sbjct: 137 EVRIMKGKDSSENKGFAFVTFRSVELASKAIDELNNAEFK 176 >ref|XP_007015802.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508786165|gb|EOY33421.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 480 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFK 122 E RIMKGKDS ENKG+AFV FR+ ELA++AI++LNN EFK Sbjct: 137 EVRIMKGKDSSENKGFAFVTFRSVELASKAIDELNNAEFK 176 >ref|XP_006487891.1| PREDICTED: nucleolin-like isoform X1 [Citrus sinensis] gi|568869353|ref|XP_006487892.1| PREDICTED: nucleolin-like isoform X2 [Citrus sinensis] Length = 479 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 3 EFRIMKGKDSGENKGYAFVAFRTEELATEAIEDLNNIEFKVKLV 134 E RIMKGKDS ENKG+AFV FR ELA++AI+ LNN EFK K + Sbjct: 130 EVRIMKGKDSSENKGFAFVTFRNVELASKAIDKLNNTEFKGKKI 173