BLASTX nr result
ID: Akebia27_contig00016359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00016359 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35059.1| hypothetical protein MIMGU_mgv1a012938mg [Mimulus... 76 4e-12 ref|XP_007051927.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|5... 76 4e-12 ref|XP_002320762.1| peroxisomal biogenesis factor 11 family prot... 75 9e-12 ref|XP_006840348.1| hypothetical protein AMTR_s00045p00107790 [A... 74 2e-11 gb|EYU32055.1| hypothetical protein MIMGU_mgv1a012957mg [Mimulus... 74 2e-11 ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-... 74 2e-11 ref|NP_001234463.1| uncharacterized protein LOC543655 [Solanum l... 74 2e-11 ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C ... 74 2e-11 ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C-... 74 3e-11 ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11C-... 74 3e-11 ref|XP_006418462.1| hypothetical protein EUTSA_v10008643mg [Eutr... 73 4e-11 ref|NP_563636.1| peroxin 11C [Arabidopsis thaliana] gi|75180079|... 73 4e-11 ref|XP_002889352.1| peroxisomal biogenesis factor 11 family prot... 73 4e-11 emb|CAD58675.1| putative peroxisomal membrane protein PEX11-1 [A... 73 4e-11 ref|XP_004133885.1| PREDICTED: peroxisomal membrane protein 11D-... 73 5e-11 gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis] 72 6e-11 gb|ACS92632.1| putative PEX11-1 protein [Triticum aestivum] 72 6e-11 gb|EMT05826.1| Peroxisomal membrane protein 11-1 [Aegilops tausc... 72 8e-11 ref|XP_007139945.1| hypothetical protein PHAVU_008G071800g [Phas... 71 1e-10 gb|AFK46771.1| unknown [Lotus japonicus] 71 1e-10 >gb|EYU35059.1| hypothetical protein MIMGU_mgv1a012938mg [Mimulus guttatus] gi|604329903|gb|EYU35060.1| hypothetical protein MIMGU_mgv1a012938mg [Mimulus guttatus] Length = 235 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 A MD+VV +GLLQLAPKK TPRV GGFGFVSSLISCYQLLPS Sbjct: 187 AAMDIVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPS 228 >ref|XP_007051927.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|590722555|ref|XP_007051928.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|508704188|gb|EOX96084.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|508704189|gb|EOX96085.1| Peroxin 11c isoform 1 [Theobroma cacao] Length = 235 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLPS Sbjct: 187 AGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 >ref|XP_002320762.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|566203052|ref|XP_006375324.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] gi|118489542|gb|ABK96573.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861535|gb|EEE99077.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|550323695|gb|ERP53121.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] Length = 235 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 + MD+VV +GLLQLAPKK TPRV GGFGFVSSLISCYQLLPS Sbjct: 187 SAMDIVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPS 228 >ref|XP_006840348.1| hypothetical protein AMTR_s00045p00107790 [Amborella trichopoda] gi|548842066|gb|ERN02023.1| hypothetical protein AMTR_s00045p00107790 [Amborella trichopoda] Length = 235 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 A MD+VV +GLL+LAPKK TPRVIG FGF+SSLISCYQLLPS Sbjct: 187 ASMDIVVAVGLLELAPKKVTPRVIGAFGFISSLISCYQLLPS 228 >gb|EYU32055.1| hypothetical protein MIMGU_mgv1a012957mg [Mimulus guttatus] gi|604321480|gb|EYU32056.1| hypothetical protein MIMGU_mgv1a012957mg [Mimulus guttatus] Length = 235 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AG+DLVV +GLLQLAPKK TPRV G FGF SSLISCYQLLPS Sbjct: 187 AGLDLVVAVGLLQLAPKKITPRVTGAFGFTSSLISCYQLLPS 228 >ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-like [Solanum tuberosum] Length = 235 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AG D+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLPS Sbjct: 187 AGTDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 >ref|NP_001234463.1| uncharacterized protein LOC543655 [Solanum lycopersicum] gi|8489788|gb|AAF75750.1|AF261140_1 unknown [Solanum lycopersicum] Length = 235 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AG D+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLPS Sbjct: 187 AGTDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 >ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C isoform 2 [Vitis vinifera] gi|225453746|ref|XP_002273544.1| PREDICTED: peroxisomal membrane protein 11C isoform 1 [Vitis vinifera] gi|296089071|emb|CBI38774.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 A MD VV +GLLQLAPKK TPRV GGFGFVSSLISCYQLLPS Sbjct: 187 AVMDTVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPS 228 >ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X1 [Solanum tuberosum] gi|565344758|ref|XP_006339471.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X2 [Solanum tuberosum] Length = 235 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AG+D+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLP+ Sbjct: 187 AGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPA 228 >ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11C-like isoform 1 [Solanum lycopersicum] gi|460367976|ref|XP_004229846.1| PREDICTED: peroxisomal membrane protein 11C-like isoform 2 [Solanum lycopersicum] Length = 235 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AG+D+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLP+ Sbjct: 187 AGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPA 228 >ref|XP_006418462.1| hypothetical protein EUTSA_v10008643mg [Eutrema salsugineum] gi|557096233|gb|ESQ36815.1| hypothetical protein EUTSA_v10008643mg [Eutrema salsugineum] Length = 235 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV GLLQLAPKK TPRV G FGF SSLISCYQLLPS Sbjct: 187 AGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPS 228 >ref|NP_563636.1| peroxin 11C [Arabidopsis thaliana] gi|75180079|sp|Q9LQ73.1|PX11C_ARATH RecName: Full=Peroxisomal membrane protein 11C; AltName: Full=Peroxin-11C; Short=AtPEX11c gi|8671852|gb|AAF78415.1|AC009273_21 Contains similarity to an unknown protein F4I18.28 gi|7486466 from Arabidopsis thaliana BAC F4I18 gb|AC004665. ESTs gb|F14309, gb|AI998750, gb|995247, gb|T14224 and gb|AI995247 come from this gene [Arabidopsis thaliana] gi|12083290|gb|AAG48804.1|AF332441_1 unknown protein [Arabidopsis thaliana] gi|17381255|gb|AAL36046.1| At1g01820/T1N6_18 [Arabidopsis thaliana] gi|20453367|gb|AAM19922.1| At1g01820/T1N6_18 [Arabidopsis thaliana] gi|21555588|gb|AAM63892.1| unknown [Arabidopsis thaliana] gi|57157092|dbj|BAD83578.1| unnamed protein product [Arabidopsis thaliana] gi|332189218|gb|AEE27339.1| peroxisomal membrane protein 11C [Arabidopsis thaliana] Length = 235 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV GLLQLAPKK TPRV G FGF SSLISCYQLLPS Sbjct: 187 AGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPS 228 >ref|XP_002889352.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335194|gb|EFH65611.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] Length = 235 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV GLLQLAPKK TPRV G FGF SSLISCYQLLPS Sbjct: 187 AGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPS 228 >emb|CAD58675.1| putative peroxisomal membrane protein PEX11-1 [Arabidopsis thaliana] Length = 235 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV GLLQLAPKK TPRV G FGF SSLISCYQLLPS Sbjct: 187 AGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPS 228 >ref|XP_004133885.1| PREDICTED: peroxisomal membrane protein 11D-like [Cucumis sativus] Length = 235 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 A MD+VV IGLLQLAPKK TPRV G FGFV+SLISCYQLLPS Sbjct: 187 AAMDVVVAIGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPS 228 >gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis] Length = 235 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 A +D+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLPS Sbjct: 187 ASVDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 >gb|ACS92632.1| putative PEX11-1 protein [Triticum aestivum] Length = 237 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV +GLLQLAPKK TPRV G FGFV+SLISCYQ LPS Sbjct: 187 AGMDVVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQQLPS 228 >gb|EMT05826.1| Peroxisomal membrane protein 11-1 [Aegilops tauschii] Length = 237 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AGMD+VV +GLLQLAPKK TPRV G FGFV+SLISCYQ LPS Sbjct: 187 AGMDVVVAVGLLQLAPKKITPRVTGAFGFVTSLISCYQQLPS 228 >ref|XP_007139945.1| hypothetical protein PHAVU_008G071800g [Phaseolus vulgaris] gi|561013078|gb|ESW11939.1| hypothetical protein PHAVU_008G071800g [Phaseolus vulgaris] Length = 235 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 AG+D+VV +GLLQLAPK TPRV G FGFVSSLISCYQLLP+ Sbjct: 187 AGIDMVVAVGLLQLAPKTVTPRVTGAFGFVSSLISCYQLLPA 228 >gb|AFK46771.1| unknown [Lotus japonicus] Length = 235 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 470 AGMDLVVVIGLLQLAPKKATPRVIGGFGFVSSLISCYQLLPS 345 A +D+VV +GLLQLAPKK TPRV G FGFVSSLISCYQLLP+ Sbjct: 187 ASIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPA 228