BLASTX nr result
ID: Akebia27_contig00016008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00016008 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB67420.1| hypothetical protein L484_009499 [Morus notabilis] 58 1e-06 >gb|EXB67420.1| hypothetical protein L484_009499 [Morus notabilis] Length = 143 Score = 58.2 bits (139), Expect = 1e-06 Identities = 41/115 (35%), Positives = 64/115 (55%), Gaps = 8/115 (6%) Frame = +2 Query: 89 LQMKRCIHIIVIKSICCL-HSASVRGPHSHQEWGGVNG----PVSLRLGWEGERTLDRW- 250 +Q+KR ++I +IK+IC + H + G H ++W G+ ++L++ +R L R Sbjct: 7 VQVKRSVYIRIIKTICSIIHGCTTCGGHVCKDWVGLIALEVAMLALKILLHVDRALVRRR 66 Query: 251 -FRRNDQFWVEERPVWLVTHGW-ADPFRW*EES*ELSFLPHFLHSLQLSEPFLQE 409 R F E++P WLVT G P R E+S +L LPH L SLQL +P L++ Sbjct: 67 PMMRRHGFGEEKQPRWLVTLGRITSPLRLGEQSQKLLLLPHLLCSLQLPKPLLKQ 121