BLASTX nr result
ID: Akebia27_contig00015636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00015636 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844484.1| hypothetical protein AMTR_s00016p00110380 [A... 63 4e-08 >ref|XP_006844484.1| hypothetical protein AMTR_s00016p00110380 [Amborella trichopoda] gi|548846955|gb|ERN06159.1| hypothetical protein AMTR_s00016p00110380 [Amborella trichopoda] Length = 1054 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/64 (45%), Positives = 44/64 (68%) Frame = -1 Query: 357 LVRVQGFGDIFQRELQDGFELSRQISGKEMLCFSHRVPASTMAGEEMDAVLSCGLWKLDS 178 L+ V+GF IFQR + +GFEL R++S E++CFSH+VPA + GEE + + G +LD Sbjct: 982 LIEVEGFRSIFQRHVHEGFELVRKLSRNELMCFSHQVPAFRVKGEEREGIPE-GCLELDP 1040 Query: 177 TALP 166 ++P Sbjct: 1041 ASMP 1044