BLASTX nr result
ID: Akebia27_contig00015374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00015374 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211614.1| hypothetical protein PRUPE_ppa005510mg [Prun... 69 5e-10 ref|XP_007211613.1| hypothetical protein PRUPE_ppa005510mg [Prun... 69 5e-10 ref|XP_007211612.1| hypothetical protein PRUPE_ppa005510mg [Prun... 69 5e-10 ref|XP_006590472.1| PREDICTED: protein ECERIFERUM 7-like isoform... 66 4e-09 ref|XP_006590471.1| PREDICTED: protein ECERIFERUM 7-like isoform... 66 4e-09 ref|XP_004288603.1| PREDICTED: exosome complex component rrp45-l... 65 7e-09 ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-l... 64 2e-08 ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-l... 64 2e-08 ref|XP_006360660.1| PREDICTED: protein ECERIFERUM 7-like [Solanu... 64 2e-08 ref|XP_004497542.1| PREDICTED: exosome complex component RRP45-l... 64 3e-08 ref|XP_004497540.1| PREDICTED: exosome complex component RRP45-l... 64 3e-08 ref|XP_003517524.1| PREDICTED: protein ECERIFERUM 7-like [Glycin... 64 3e-08 gb|EXB93334.1| Exosome complex component rrp45 [Morus notabilis] 63 4e-08 ref|XP_006858247.1| hypothetical protein AMTR_s00062p00201720 [A... 63 5e-08 emb|CBI18186.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-l... 63 5e-08 emb|CAN74356.1| hypothetical protein VITISV_000912 [Vitis vinifera] 63 5e-08 gb|EYU31392.1| hypothetical protein MIMGU_mgv1a023208mg, partial... 62 6e-08 ref|XP_007156994.1| hypothetical protein PHAVU_002G034700g [Phas... 62 8e-08 gb|AGZ15366.1| exosome complex exonuclease RRP45 [Phaseolus vulg... 62 8e-08 >ref|XP_007211614.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] gi|462407479|gb|EMJ12813.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] Length = 457 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRM++NEKKFIETALLSDLR+DGRRP Sbjct: 1 MEQRLANTWRMSVNEKKFIETALLSDLRIDGRRP 34 >ref|XP_007211613.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] gi|462407478|gb|EMJ12812.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] Length = 385 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRM++NEKKFIETALLSDLR+DGRRP Sbjct: 1 MEQRLANTWRMSVNEKKFIETALLSDLRIDGRRP 34 >ref|XP_007211612.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] gi|462407477|gb|EMJ12811.1| hypothetical protein PRUPE_ppa005510mg [Prunus persica] Length = 369 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRM++NEKKFIETALLSDLR+DGRRP Sbjct: 1 MEQRLANTWRMSVNEKKFIETALLSDLRIDGRRP 34 >ref|XP_006590472.1| PREDICTED: protein ECERIFERUM 7-like isoform X2 [Glycine max] Length = 357 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRM +N+KKFIETALLSDLR+DGRRP Sbjct: 1 MEQRLANTWRMPLNDKKFIETALLSDLRLDGRRP 34 >ref|XP_006590471.1| PREDICTED: protein ECERIFERUM 7-like isoform X1 [Glycine max] Length = 438 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRM +N+KKFIETALLSDLR+DGRRP Sbjct: 1 MEQRLANTWRMPLNDKKFIETALLSDLRLDGRRP 34 >ref|XP_004288603.1| PREDICTED: exosome complex component rrp45-like [Fragaria vesca subsp. vesca] Length = 465 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRMT+NEKKFIETAL S LR+DGRRP Sbjct: 1 MEQRLANTWRMTVNEKKFIETALESGLRIDGRRP 34 >ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 454 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWR++ NEKKFIETALLSDLRVDGR P Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGP 34 >ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 452 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWR++ NEKKFIETALLSDLRVDGR P Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGP 34 >ref|XP_006360660.1| PREDICTED: protein ECERIFERUM 7-like [Solanum tuberosum] Length = 443 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRL NTWRMT+NEKKFIE+AL S+LRVDGRRP Sbjct: 1 MEQRLGNTWRMTVNEKKFIESALESELRVDGRRP 34 >ref|XP_004497542.1| PREDICTED: exosome complex component RRP45-like isoform X3 [Cicer arietinum] Length = 449 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLAN WR+T+NEKKFIE+ALLSDLRVDGR P Sbjct: 1 MEQRLANCWRLTVNEKKFIESALLSDLRVDGRGP 34 >ref|XP_004497540.1| PREDICTED: exosome complex component RRP45-like isoform X1 [Cicer arietinum] gi|502122023|ref|XP_004497541.1| PREDICTED: exosome complex component RRP45-like isoform X2 [Cicer arietinum] Length = 450 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLAN WR+T+NEKKFIE+ALLSDLRVDGR P Sbjct: 1 MEQRLANCWRLTVNEKKFIESALLSDLRVDGRGP 34 >ref|XP_003517524.1| PREDICTED: protein ECERIFERUM 7-like [Glycine max] Length = 350 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTWRM N+ KFIETALLSDLRVDGRRP Sbjct: 1 MEQRLANTWRMPRNDNKFIETALLSDLRVDGRRP 34 >gb|EXB93334.1| Exosome complex component rrp45 [Morus notabilis] Length = 451 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLAN+WR+T+NEKKFIETALL LR+DGRRP Sbjct: 1 MEQRLANSWRLTVNEKKFIETALLPALRIDGRRP 34 >ref|XP_006858247.1| hypothetical protein AMTR_s00062p00201720 [Amborella trichopoda] gi|548862350|gb|ERN19714.1| hypothetical protein AMTR_s00062p00201720 [Amborella trichopoda] Length = 421 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLAN WRM++NEKKFIE ALLSD RVDGRRP Sbjct: 1 MEQRLANIWRMSVNEKKFIENALLSDHRVDGRRP 34 >emb|CBI18186.3| unnamed protein product [Vitis vinifera] Length = 53 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLA+T+RMT+NEKKFIE ALLSDLR+DGRRP Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRP 34 >ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-like [Vitis vinifera] Length = 467 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLA+T+RMT+NEKKFIE ALLSDLR+DGRRP Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRP 34 >emb|CAN74356.1| hypothetical protein VITISV_000912 [Vitis vinifera] Length = 476 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLA+T+RMT+NEKKFIE ALLSDLR+DGRRP Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRP 34 >gb|EYU31392.1| hypothetical protein MIMGU_mgv1a023208mg, partial [Mimulus guttatus] Length = 290 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLANTW+MT+NEK FIETALLS+LR+DGR P Sbjct: 1 MEQRLANTWKMTLNEKLFIETALLSELRIDGRGP 34 >ref|XP_007156994.1| hypothetical protein PHAVU_002G034700g [Phaseolus vulgaris] gi|561030409|gb|ESW28988.1| hypothetical protein PHAVU_002G034700g [Phaseolus vulgaris] Length = 447 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLAN+WRM +N+ KFIE ALLSDLRVDGRRP Sbjct: 1 MEQRLANSWRMPLNDNKFIEAALLSDLRVDGRRP 34 >gb|AGZ15366.1| exosome complex exonuclease RRP45 [Phaseolus vulgaris] Length = 449 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 MEQRLANTWRMTINEKKFIETALLSDLRVDGRRP 2 MEQRLAN+WRM +N+ KFIE ALLSDLRVDGRRP Sbjct: 1 MEQRLANSWRMPLNDNKFIEAALLSDLRVDGRRP 34