BLASTX nr result
ID: Akebia27_contig00014787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00014787 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007585664.1| hypothetical protein UCRNP2_6396 [Neofusicoc... 59 9e-07 >ref|XP_007585664.1| hypothetical protein UCRNP2_6396 [Neofusicoccum parvum UCRNP2] gi|485921049|gb|EOD46867.1| hypothetical protein UCRNP2_6396 [Neofusicoccum parvum UCRNP2] Length = 85 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = +1 Query: 193 QFDLEQPRASMARYNQLMHQHTKQQLESFTGDVRRGSTSDGQGSLNSESS 342 Q+DL+ P ASM+ Y+++MH+HTK QLES T RR S S+NSESS Sbjct: 27 QYDLDNPTASMSIYSRVMHEHTKHQLESATSSARRRSQGGSNASMNSESS 76