BLASTX nr result
ID: Akebia27_contig00014608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00014608 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849334.1| hypothetical protein AMTR_s00164p00047870 [A... 55 8e-06 >ref|XP_006849334.1| hypothetical protein AMTR_s00164p00047870 [Amborella trichopoda] gi|548852855|gb|ERN10915.1| hypothetical protein AMTR_s00164p00047870 [Amborella trichopoda] Length = 884 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/76 (42%), Positives = 39/76 (51%), Gaps = 1/76 (1%) Frame = +3 Query: 3 EQIHGLGRGGNLPLGAVKALEESNKQQDQQEFNATE-TXXXXXXXXXXXXXXXXXXXXXX 179 + IHGLGRGGN+P+GAVK L +SN+ + A E + Sbjct: 809 DTIHGLGRGGNIPVGAVKMLMDSNENSNLVSDVAEEVSGRGRGGSNFRGRGQGRGGRNHF 868 Query: 180 XKDRAMKKHFAGLGGY 227 KDRAMKKHF GL GY Sbjct: 869 RKDRAMKKHFTGLSGY 884