BLASTX nr result
ID: Akebia27_contig00014536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00014536 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536224.1| PREDICTED: probable serine/threonine protein... 57 2e-06 ref|XP_007035143.1| Calcium-binding EF-hand family protein isofo... 55 8e-06 ref|XP_007035142.1| Calcium-binding EF-hand family protein isofo... 55 8e-06 ref|XP_007035140.1| Calcium-binding EF-hand family protein isofo... 55 8e-06 >ref|XP_003536224.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like [Glycine max] Length = 541 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 318 SLDPELLQIPEVSPLALKSNPYIAEELFSQW 410 SLDP+LLQ+PEVSP ALKS+PY+ EELF+QW Sbjct: 12 SLDPDLLQLPEVSPFALKSSPYVVEELFTQW 42 >ref|XP_007035143.1| Calcium-binding EF-hand family protein isoform 4 [Theobroma cacao] gi|508714172|gb|EOY06069.1| Calcium-binding EF-hand family protein isoform 4 [Theobroma cacao] Length = 420 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 318 SLDPELLQIPEVSPLALKSNPYIAEELFSQW 410 SLDP+ LQ+PE+SPLALKSNP++AEELFS W Sbjct: 11 SLDPDSLQLPELSPLALKSNPFLAEELFSLW 41 >ref|XP_007035142.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao] gi|508714171|gb|EOY06068.1| Calcium-binding EF-hand family protein isoform 3 [Theobroma cacao] Length = 485 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 318 SLDPELLQIPEVSPLALKSNPYIAEELFSQW 410 SLDP+ LQ+PE+SPLALKSNP++AEELFS W Sbjct: 11 SLDPDSLQLPELSPLALKSNPFLAEELFSLW 41 >ref|XP_007035140.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] gi|590659488|ref|XP_007035141.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] gi|508714169|gb|EOY06066.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] gi|508714170|gb|EOY06067.1| Calcium-binding EF-hand family protein isoform 1 [Theobroma cacao] Length = 536 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 318 SLDPELLQIPEVSPLALKSNPYIAEELFSQW 410 SLDP+ LQ+PE+SPLALKSNP++AEELFS W Sbjct: 11 SLDPDSLQLPELSPLALKSNPFLAEELFSLW 41