BLASTX nr result
ID: Akebia27_contig00014535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00014535 (696 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536224.1| PREDICTED: probable serine/threonine protein... 59 2e-06 >ref|XP_003536224.1| PREDICTED: probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma-like [Glycine max] Length = 541 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 604 SLDPELLQIPEVSPLALKSNPYIVEELFSQW 696 SLDP+LLQ+PEVSP ALKS+PY+VEELF+QW Sbjct: 12 SLDPDLLQLPEVSPFALKSSPYVVEELFTQW 42