BLASTX nr result
ID: Akebia27_contig00014506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00014506 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU17477.1| unknown [Glycine max] 61 2e-07 >gb|ACU17477.1| unknown [Glycine max] Length = 76 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +2 Query: 236 MSSEAVALR*ARVEPPPNIKNLSNKPLLVNGAANV 340 MS EAVAL+ ARVEPPPNIKNLSN PL VNGAANV Sbjct: 1 MSPEAVALKYARVEPPPNIKNLSNNPLFVNGAANV 35