BLASTX nr result
ID: Akebia27_contig00013839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00013839 (720 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616406.1| Splicing factor, arginine/serine-rich 13A [M... 64 5e-08 ref|XP_006403456.1| hypothetical protein EUTSA_v10010627mg [Eutr... 64 7e-08 ref|XP_006291521.1| hypothetical protein CARUB_v10017670mg, part... 64 7e-08 ref|XP_002876304.1| hypothetical protein ARALYDRAFT_485973 [Arab... 64 7e-08 emb|CAB75904.1| putative RNA binding protein [Arabidopsis thaliana] 63 9e-08 emb|CAC03602.1| SC35-like splicing factor SCL30, 30 kD [Arabidop... 63 9e-08 ref|NP_567021.1| SC35-like splicing factor 30 [Arabidopsis thali... 63 9e-08 gb|AGZ15399.1| unknown [Phaseolus vulgaris] 62 1e-07 gb|AGV54513.1| splicing factor arginine/serine-rich 13A [Phaseol... 62 1e-07 ref|NP_001067091.1| Os12g0572400 [Oryza sativa Japonica Group] g... 62 1e-07 ref|XP_003545260.1| PREDICTED: serine/arginine-rich splicing fac... 62 1e-07 ref|XP_003518382.1| PREDICTED: serine/arginine-rich splicing fac... 62 1e-07 gb|EEC69539.1| hypothetical protein OsI_38819 [Oryza sativa Indi... 62 1e-07 dbj|BAC78592.1| pre-mRNA splicing factor [Oryza sativa Japonica ... 62 1e-07 ref|XP_006647123.1| PREDICTED: serine/arginine-rich splicing fac... 62 3e-07 ref|XP_007141872.1| hypothetical protein PHAVU_008G232900g [Phas... 62 3e-07 gb|EMT23970.1| 35 kDa SR repressor protein [Aegilops tauschii] 62 3e-07 ref|NP_001046448.1| Os02g0252100 [Oryza sativa Japonica Group] g... 62 3e-07 dbj|BAJ91767.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 3e-07 emb|CBI31687.3| unnamed protein product [Vitis vinifera] 62 3e-07 >ref|XP_003616406.1| Splicing factor, arginine/serine-rich 13A [Medicago truncatula] gi|355517741|gb|AES99364.1| Splicing factor, arginine/serine-rich 13A [Medicago truncatula] Length = 286 Score = 63.9 bits (154), Expect = 5e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 +CRPE+LRAPFERFGPVRDVY+PKDYYSG Sbjct: 57 DCRPEELRAPFERFGPVRDVYIPKDYYSG 85 >ref|XP_006403456.1| hypothetical protein EUTSA_v10010627mg [Eutrema salsugineum] gi|557104575|gb|ESQ44909.1| hypothetical protein EUTSA_v10010627mg [Eutrema salsugineum] Length = 272 Score = 63.5 bits (153), Expect = 7e-08 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFEVKTSPRPAYDEG 143 +CRPE+LR PFERFGPVRDVY+P+DYYSG GF + E AYD G Sbjct: 49 DCRPEELRVPFERFGPVRDVYIPRDYYSGEPRGFAFVEFV----DAYDAG 94 >ref|XP_006291521.1| hypothetical protein CARUB_v10017670mg, partial [Capsella rubella] gi|482560228|gb|EOA24419.1| hypothetical protein CARUB_v10017670mg, partial [Capsella rubella] Length = 315 Score = 63.5 bits (153), Expect = 7e-08 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFEVKTSPRPAYDEG 143 +CRPE+LR PFERFGPVRDVY+P+DYYSG GF + E AYD G Sbjct: 92 DCRPEELRVPFERFGPVRDVYIPRDYYSGEPRGFAFVEFV----DAYDAG 137 >ref|XP_002876304.1| hypothetical protein ARALYDRAFT_485973 [Arabidopsis lyrata subsp. lyrata] gi|297322142|gb|EFH52563.1| hypothetical protein ARALYDRAFT_485973 [Arabidopsis lyrata subsp. lyrata] Length = 260 Score = 63.5 bits (153), Expect = 7e-08 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFEVKTSPRPAYDEG 143 +CRPE+LR PFERFGPVRDVY+P+DYYSG GF + E AYD G Sbjct: 56 DCRPEELRVPFERFGPVRDVYIPRDYYSGEPRGFAFVEFV----DAYDAG 101 >emb|CAB75904.1| putative RNA binding protein [Arabidopsis thaliana] Length = 309 Score = 63.2 bits (152), Expect = 9e-08 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFEVKTSPRPAYDEG 143 +CRPE+LR PFERFGPVRDVY+P+DYYSG GF + E AYD G Sbjct: 57 DCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFV----DAYDAG 102 >emb|CAC03602.1| SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] Length = 262 Score = 63.2 bits (152), Expect = 9e-08 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFEVKTSPRPAYDEG 143 +CRPE+LR PFERFGPVRDVY+P+DYYSG GF + E AYD G Sbjct: 57 DCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFV----DAYDAG 102 >ref|NP_567021.1| SC35-like splicing factor 30 [Arabidopsis thaliana] gi|20466366|gb|AAM20500.1| putative RNA binding protein [Arabidopsis thaliana] gi|21554261|gb|AAM63336.1| putative RNA binding protein [Arabidopsis thaliana] gi|22136316|gb|AAM91236.1| putative RNA binding protein [Arabidopsis thaliana] gi|332645866|gb|AEE79387.1| SC35-like splicing factor 30 [Arabidopsis thaliana] Length = 262 Score = 63.2 bits (152), Expect = 9e-08 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 3/50 (6%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFEVKTSPRPAYDEG 143 +CRPE+LR PFERFGPVRDVY+P+DYYSG GF + E AYD G Sbjct: 57 DCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFV----DAYDAG 102 >gb|AGZ15399.1| unknown [Phaseolus vulgaris] Length = 267 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 +CRPE+LR PFERFGPVRDVY+PKDYYSG Sbjct: 49 DCRPEELRVPFERFGPVRDVYIPKDYYSG 77 >gb|AGV54513.1| splicing factor arginine/serine-rich 13A [Phaseolus vulgaris] Length = 267 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 +CRPE+LR PFERFGPVRDVY+PKDYYSG Sbjct: 49 DCRPEELRVPFERFGPVRDVYIPKDYYSG 77 >ref|NP_001067091.1| Os12g0572400 [Oryza sativa Japonica Group] gi|77556878|gb|ABA99674.1| RNA recognition motif family protein, expressed [Oryza sativa Japonica Group] gi|113649598|dbj|BAF30110.1| Os12g0572400 [Oryza sativa Japonica Group] gi|215694562|dbj|BAG89555.1| unnamed protein product [Oryza sativa Japonica Group] gi|222617335|gb|EEE53467.1| hypothetical protein OsJ_36595 [Oryza sativa Japonica Group] Length = 263 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFE 107 +CR EDLR PFERFGPVRDVYLPKDYYSG GF + E Sbjct: 47 SCRGEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVE 84 >ref|XP_003545260.1| PREDICTED: serine/arginine-rich splicing factor 33-like [Glycine max] Length = 271 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 +CRPE+LR PFERFGPVRDVY+PKDYYSG Sbjct: 50 DCRPEELRVPFERFGPVRDVYIPKDYYSG 78 >ref|XP_003518382.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X1 [Glycine max] gi|571441631|ref|XP_006575502.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X2 [Glycine max] Length = 276 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 +CRPE+LR PFERFGPVRDVY+PKDYYSG Sbjct: 57 DCRPEELRVPFERFGPVRDVYIPKDYYSG 85 >gb|EEC69539.1| hypothetical protein OsI_38819 [Oryza sativa Indica Group] Length = 263 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFE 107 +CR EDLR PFERFGPVRDVYLPKDYYSG GF + E Sbjct: 47 SCRGEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVE 84 >dbj|BAC78592.1| pre-mRNA splicing factor [Oryza sativa Japonica Group] Length = 232 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFE 107 +CR EDLR PFERFGPVRDVYLPKDYYSG GF + E Sbjct: 16 SCRGEDLRVPFERFGPVRDVYLPKDYYSGEPRGFAFVE 53 >ref|XP_006647123.1| PREDICTED: serine/arginine-rich splicing factor 33-like [Oryza brachyantha] Length = 263 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFE 107 +CR EDLR PFERFGPVRDVYLPKDYY+G GF + E Sbjct: 47 SCRAEDLRVPFERFGPVRDVYLPKDYYTGEPRGFAFVE 84 >ref|XP_007141872.1| hypothetical protein PHAVU_008G232900g [Phaseolus vulgaris] gi|561015005|gb|ESW13866.1| hypothetical protein PHAVU_008G232900g [Phaseolus vulgaris] Length = 267 Score = 61.6 bits (148), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 +CRPE+LR PFERFGPVRDVY+PKDYYSG Sbjct: 49 DCRPEELRFPFERFGPVRDVYIPKDYYSG 77 >gb|EMT23970.1| 35 kDa SR repressor protein [Aegilops tauschii] Length = 333 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYS---GGFCWFE 107 +CRPEDLR PFERFGPVRDVYLPKDYY+ GF + E Sbjct: 111 SCRPEDLRVPFERFGPVRDVYLPKDYYTREPRGFAFVE 148 >ref|NP_001046448.1| Os02g0252100 [Oryza sativa Japonica Group] gi|47497118|dbj|BAD19168.1| putative pre-mRNA splicing factor [Oryza sativa Japonica Group] gi|47497696|dbj|BAD19762.1| putative pre-mRNA splicing factor [Oryza sativa Japonica Group] gi|66394215|gb|AAG43284.2| pre-mRNA splicing factor [Oryza sativa] gi|113535979|dbj|BAF08362.1| Os02g0252100 [Oryza sativa Japonica Group] gi|215704460|dbj|BAG93894.1| unnamed protein product [Oryza sativa Japonica Group] Length = 265 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG---GFCWFE 107 +CR EDLR PFERFGPVRDVYLPKDYY+G GF + E Sbjct: 47 SCRAEDLRVPFERFGPVRDVYLPKDYYTGEPRGFAFVE 84 >dbj|BAJ91767.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 262 Score = 61.6 bits (148), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYS---GGFCWFE 107 +CRPEDLR PFERFGPVRDVYLPKDYY+ GF + E Sbjct: 47 SCRPEDLRVPFERFGPVRDVYLPKDYYTREPRGFAFVE 84 >emb|CBI31687.3| unnamed protein product [Vitis vinifera] Length = 353 Score = 61.6 bits (148), Expect = 3e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 NCRPEDLRAPFERFGPVRDVYLPKDYYSG 89 NCRPEDLR PFERFG VRDVYLPKDYY+G Sbjct: 127 NCRPEDLRVPFERFGLVRDVYLPKDYYTG 155