BLASTX nr result
ID: Akebia27_contig00013791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00013791 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27321.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002281596.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 58 2e-06 gb|EYU44242.1| hypothetical protein MIMGU_mgv1a013043mg [Mimulus... 57 4e-06 ref|XP_006408428.1| hypothetical protein EUTSA_v10021465mg [Eutr... 56 5e-06 ref|XP_006405685.1| hypothetical protein EUTSA_v10027926mg [Eutr... 56 5e-06 dbj|BAB08646.1| unnamed protein product [Arabidopsis thaliana] 56 5e-06 ref|NP_001190437.1| RING/U-box superfamily protein [Arabidopsis ... 56 5e-06 ref|NP_001190436.1| RING/U-box superfamily protein [Arabidopsis ... 56 5e-06 ref|XP_002870814.1| zinc finger family protein [Arabidopsis lyra... 56 5e-06 gb|ABD96936.1| hypothetical protein [Cleome spinosa] 56 5e-06 gb|ABD96894.1| hypothetical protein [Cleome spinosa] 56 5e-06 ref|NP_568560.1| RING/U-box superfamily protein [Arabidopsis tha... 56 5e-06 ref|XP_004304199.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 56 6e-06 ref|XP_007217755.1| hypothetical protein PRUPE_ppa011007mg [Prun... 56 6e-06 gb|EYU34585.1| hypothetical protein MIMGU_mgv1a013204mg [Mimulus... 55 8e-06 ref|XP_006482437.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 55 8e-06 ref|XP_006430956.1| hypothetical protein CICLE_v10012668mg [Citr... 55 8e-06 ref|XP_007032876.1| RING/U-box superfamily protein [Theobroma ca... 55 8e-06 >emb|CBI27321.3| unnamed protein product [Vitis vinifera] Length = 141 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSFLLDGS 331 +FHLGCIYEW+ERS+TCPVC KVTSF S Sbjct: 98 HFHLGCIYEWLERSQTCPVCSKVTSFYYTSS 128 >ref|XP_002281596.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Vitis vinifera] gi|298204451|emb|CBI16931.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSETCPVCGKV F Sbjct: 196 HFHLGCIYEWMERSETCPVCGKVMMF 221 >gb|EYU44242.1| hypothetical protein MIMGU_mgv1a013043mg [Mimulus guttatus] Length = 232 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV +F Sbjct: 203 HFHLGCIYEWMERSENCPVCGKVMAF 228 >ref|XP_006408428.1| hypothetical protein EUTSA_v10021465mg [Eutrema salsugineum] gi|557109574|gb|ESQ49881.1| hypothetical protein EUTSA_v10021465mg [Eutrema salsugineum] Length = 226 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV F Sbjct: 197 HFHLGCIYEWMERSENCPVCGKVMEF 222 >ref|XP_006405685.1| hypothetical protein EUTSA_v10027926mg [Eutrema salsugineum] gi|557106823|gb|ESQ47138.1| hypothetical protein EUTSA_v10027926mg [Eutrema salsugineum] Length = 219 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHL CIYEWMERSETCPVCGKV +F Sbjct: 190 HFHLSCIYEWMERSETCPVCGKVMAF 215 >dbj|BAB08646.1| unnamed protein product [Arabidopsis thaliana] Length = 223 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHL CIYEWMERSETCPVCGKV +F Sbjct: 192 HFHLSCIYEWMERSETCPVCGKVMAF 217 >ref|NP_001190437.1| RING/U-box superfamily protein [Arabidopsis thaliana] gi|332006989|gb|AED94372.1| RING/U-box superfamily protein [Arabidopsis thaliana] Length = 296 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHL CIYEWMERSETCPVCGKV +F Sbjct: 265 HFHLSCIYEWMERSETCPVCGKVMAF 290 >ref|NP_001190436.1| RING/U-box superfamily protein [Arabidopsis thaliana] gi|332006988|gb|AED94371.1| RING/U-box superfamily protein [Arabidopsis thaliana] Length = 326 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHL CIYEWMERSETCPVCGKV +F Sbjct: 295 HFHLSCIYEWMERSETCPVCGKVMAF 320 >ref|XP_002870814.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297316650|gb|EFH47073.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 221 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHL CIYEWMERSETCPVCGKV +F Sbjct: 190 HFHLSCIYEWMERSETCPVCGKVMAF 215 >gb|ABD96936.1| hypothetical protein [Cleome spinosa] Length = 278 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV F Sbjct: 249 HFHLGCIYEWMERSENCPVCGKVMEF 274 >gb|ABD96894.1| hypothetical protein [Cleome spinosa] Length = 229 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV F Sbjct: 200 HFHLGCIYEWMERSENCPVCGKVMEF 225 >ref|NP_568560.1| RING/U-box superfamily protein [Arabidopsis thaliana] gi|14334948|gb|AAK59651.1| unknown protein [Arabidopsis thaliana] gi|23297720|gb|AAN12910.1| unknown protein [Arabidopsis thaliana] gi|332006987|gb|AED94370.1| RING/U-box superfamily protein [Arabidopsis thaliana] Length = 221 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHL CIYEWMERSETCPVCGKV +F Sbjct: 190 HFHLSCIYEWMERSETCPVCGKVMAF 215 >ref|XP_004304199.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Fragaria vesca subsp. vesca] Length = 227 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 ++HLGCIYEWMERSE+CPVCGKV +F Sbjct: 198 HYHLGCIYEWMERSESCPVCGKVMAF 223 >ref|XP_007217755.1| hypothetical protein PRUPE_ppa011007mg [Prunus persica] gi|462413905|gb|EMJ18954.1| hypothetical protein PRUPE_ppa011007mg [Prunus persica] Length = 227 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE+CPVCGKV F Sbjct: 198 HFHLGCIYEWMERSESCPVCGKVMVF 223 >gb|EYU34585.1| hypothetical protein MIMGU_mgv1a013204mg [Mimulus guttatus] Length = 228 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERS+ CPVCGKV +F Sbjct: 199 HFHLGCIYEWMERSDNCPVCGKVMAF 224 >ref|XP_006482437.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Citrus sinensis] Length = 227 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV F Sbjct: 198 HFHLGCIYEWMERSENCPVCGKVMVF 223 >ref|XP_006430956.1| hypothetical protein CICLE_v10012668mg [Citrus clementina] gi|557533013|gb|ESR44196.1| hypothetical protein CICLE_v10012668mg [Citrus clementina] Length = 227 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV F Sbjct: 198 HFHLGCIYEWMERSENCPVCGKVMVF 223 >ref|XP_007032876.1| RING/U-box superfamily protein [Theobroma cacao] gi|508711905|gb|EOY03802.1| RING/U-box superfamily protein [Theobroma cacao] Length = 225 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/26 (84%), Positives = 23/26 (88%) Frame = +2 Query: 239 NFHLGCIYEWMERSETCPVCGKVTSF 316 +FHLGCIYEWMERSE CPVCGKV F Sbjct: 196 HFHLGCIYEWMERSENCPVCGKVMVF 221