BLASTX nr result
ID: Akebia27_contig00013309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00013309 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220220.1| hypothetical protein PRUPE_ppa002188mg [Prun... 62 9e-08 gb|ABV53464.1| pseudo-response regulator 5 [Castanea sativa] 62 9e-08 gb|ABV53465.1| pseudo-response regulator 9 [Castanea sativa] 62 2e-07 ref|XP_007039206.1| Pseudo-response regulator 5, putative isofor... 61 2e-07 ref|XP_007039205.1| Pseudo-response regulator 5, putative isofor... 61 2e-07 dbj|BAE72698.1| pseudo-response regulator 59 homologue [Lemna pa... 61 3e-07 ref|XP_007139020.1| hypothetical protein PHAVU_009G258300g [Phas... 60 4e-07 ref|XP_004160390.1| PREDICTED: two-component response regulator-... 60 4e-07 ref|XP_004145958.1| PREDICTED: two-component response regulator-... 60 4e-07 gb|AEA50850.1| aprr5 [Populus tremula] 60 4e-07 dbj|BAJ83828.1| circadian response regulator 2a [Physcomitrella ... 60 4e-07 ref|XP_002321349.1| PSEUDO-RESPONSE REGULATOR 5 family protein [... 60 4e-07 ref|XP_002318502.1| hypothetical protein POPTR_0012s00600g [Popu... 60 4e-07 dbj|BAJ83829.1| circadian response regulator 2b [Physcomitrella ... 60 5e-07 gb|EXB78384.1| Two-component response regulator-like protein [Mo... 59 1e-06 ref|NP_566085.1| two-component response regulator-like APRR9 [Ar... 59 1e-06 ref|XP_006578871.1| PREDICTED: two-component response regulator-... 59 1e-06 ref|XP_006578870.1| PREDICTED: two-component response regulator-... 59 1e-06 ref|XP_007136435.1| hypothetical protein PHAVU_009G045000g [Phas... 59 1e-06 ref|XP_007136434.1| hypothetical protein PHAVU_009G045000g [Phas... 59 1e-06 >ref|XP_007220220.1| hypothetical protein PRUPE_ppa002188mg [Prunus persica] gi|462416682|gb|EMJ21419.1| hypothetical protein PRUPE_ppa002188mg [Prunus persica] Length = 703 Score = 62.4 bits (150), Expect = 9e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSSSSL 113 YDKKVRY+SRK+LAEQRPR+KGQFVRQV DPS + + Sbjct: 660 YDKKVRYESRKKLAEQRPRIKGQFVRQVNTDPSPAEV 696 >gb|ABV53464.1| pseudo-response regulator 5 [Castanea sativa] Length = 698 Score = 62.4 bits (150), Expect = 9e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSSSSL 113 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV DPS S + Sbjct: 655 YEKKVRYESRKKLAEQRPRVKGQFVRQVHIDPSPSEI 691 >gb|ABV53465.1| pseudo-response regulator 9 [Castanea sativa] Length = 700 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 YDKKVRY SRKRLAEQRPRVKGQFVRQV DP Sbjct: 662 YDKKVRYHSRKRLAEQRPRVKGQFVRQVQTDP 693 >ref|XP_007039206.1| Pseudo-response regulator 5, putative isoform 2 [Theobroma cacao] gi|508776451|gb|EOY23707.1| Pseudo-response regulator 5, putative isoform 2 [Theobroma cacao] Length = 695 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV ADP Sbjct: 649 YEKKVRYESRKKLAEQRPRVKGQFVRQVQADP 680 >ref|XP_007039205.1| Pseudo-response regulator 5, putative isoform 1 [Theobroma cacao] gi|508776450|gb|EOY23706.1| Pseudo-response regulator 5, putative isoform 1 [Theobroma cacao] Length = 689 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV ADP Sbjct: 643 YEKKVRYESRKKLAEQRPRVKGQFVRQVQADP 674 >dbj|BAE72698.1| pseudo-response regulator 59 homologue [Lemna paucicostata] Length = 501 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSSSSL 113 ++KKVRY SRK LAEQRPRVKGQFVRQ +ADPS+ S+ Sbjct: 459 FEKKVRYHSRKMLAEQRPRVKGQFVRQAVADPSAFSM 495 >ref|XP_007139020.1| hypothetical protein PHAVU_009G258300g [Phaseolus vulgaris] gi|593331189|ref|XP_007139021.1| hypothetical protein PHAVU_009G258300g [Phaseolus vulgaris] gi|561012107|gb|ESW11014.1| hypothetical protein PHAVU_009G258300g [Phaseolus vulgaris] gi|561012108|gb|ESW11015.1| hypothetical protein PHAVU_009G258300g [Phaseolus vulgaris] Length = 660 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSSSSL 113 Y+KKVRYQSRKRLAEQRPRVKGQFVRQV +D S L Sbjct: 620 YEKKVRYQSRKRLAEQRPRVKGQFVRQVHSDHPVSDL 656 >ref|XP_004160390.1| PREDICTED: two-component response regulator-like PRR95-like [Cucumis sativus] Length = 696 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 Y+KKVRY+SRK+LAEQRPRVKGQFVR+VL DP Sbjct: 653 YEKKVRYESRKKLAEQRPRVKGQFVRRVLTDP 684 >ref|XP_004145958.1| PREDICTED: two-component response regulator-like PRR95-like [Cucumis sativus] Length = 696 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 Y+KKVRY+SRK+LAEQRPRVKGQFVR+VL DP Sbjct: 653 YEKKVRYESRKKLAEQRPRVKGQFVRRVLTDP 684 >gb|AEA50850.1| aprr5 [Populus tremula] Length = 412 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPS 101 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV DPS Sbjct: 376 YEKKVRYESRKKLAEQRPRVKGQFVRQVHIDPS 408 >dbj|BAJ83828.1| circadian response regulator 2a [Physcomitrella patens] Length = 915 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSSSS 110 ++KKVRYQSRKRLAEQRPRV+GQFVRQ + DPS+ + Sbjct: 878 FEKKVRYQSRKRLAEQRPRVRGQFVRQAVYDPSAGN 913 >ref|XP_002321349.1| PSEUDO-RESPONSE REGULATOR 5 family protein [Populus trichocarpa] gi|222868345|gb|EEF05476.1| PSEUDO-RESPONSE REGULATOR 5 family protein [Populus trichocarpa] Length = 687 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPS 101 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV DPS Sbjct: 649 YEKKVRYESRKKLAEQRPRVKGQFVRQVHIDPS 681 >ref|XP_002318502.1| hypothetical protein POPTR_0012s00600g [Populus trichocarpa] gi|222859175|gb|EEE96722.1| hypothetical protein POPTR_0012s00600g [Populus trichocarpa] Length = 529 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPS 101 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV DPS Sbjct: 491 YEKKVRYESRKKLAEQRPRVKGQFVRQVHIDPS 523 >dbj|BAJ83829.1| circadian response regulator 2b [Physcomitrella patens] Length = 917 Score = 60.1 bits (144), Expect = 5e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSS 104 ++KKVRYQSRKRLAEQRPRV+GQFVRQ + DPS+ Sbjct: 880 FEKKVRYQSRKRLAEQRPRVRGQFVRQAVHDPSA 913 >gb|EXB78384.1| Two-component response regulator-like protein [Morus notabilis] Length = 698 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 ++KKVRY+SRK+LAEQRPRVKGQFVRQVL +P Sbjct: 658 FEKKVRYESRKKLAEQRPRVKGQFVRQVLTEP 689 >ref|NP_566085.1| two-component response regulator-like APRR9 [Arabidopsis thaliana] gi|52783231|sp|Q8L500.2|APRR9_ARATH RecName: Full=Two-component response regulator-like APRR9; AltName: Full=Pseudo-response regulator 9 gi|9247022|gb|AAF86253.1|AF272040_1 timing of CAB expression 1-like protein [Arabidopsis thaliana] gi|10281000|dbj|BAB13741.1| pseudo-response regulator 9 [Arabidopsis thaliana] gi|20197322|gb|AAC33497.2| expressed protein [Arabidopsis thaliana] gi|62320652|dbj|BAD95319.1| hypothetical protein [Arabidopsis thaliana] gi|330255660|gb|AEC10754.1| two-component response regulator-like APRR9 [Arabidopsis thaliana] Length = 468 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADPSSSS 110 +DKKVRYQSRK+LAEQRPRVKGQFVR V +D S+ S Sbjct: 433 FDKKVRYQSRKKLAEQRPRVKGQFVRTVNSDASTKS 468 >ref|XP_006578871.1| PREDICTED: two-component response regulator-like PRR95-like isoform X3 [Glycine max] Length = 575 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV DP Sbjct: 529 YEKKVRYESRKKLAEQRPRVKGQFVRQVHPDP 560 >ref|XP_006578870.1| PREDICTED: two-component response regulator-like PRR95-like isoform X2 [Glycine max] Length = 691 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLADP 98 Y+KKVRY+SRK+LAEQRPRVKGQFVRQV DP Sbjct: 645 YEKKVRYESRKKLAEQRPRVKGQFVRQVHPDP 676 >ref|XP_007136435.1| hypothetical protein PHAVU_009G045000g [Phaseolus vulgaris] gi|561009522|gb|ESW08429.1| hypothetical protein PHAVU_009G045000g [Phaseolus vulgaris] Length = 690 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLAD 95 Y+KKVRY+SRK+LAEQRPRVKGQFVRQVL D Sbjct: 636 YEKKVRYESRKKLAEQRPRVKGQFVRQVLPD 666 >ref|XP_007136434.1| hypothetical protein PHAVU_009G045000g [Phaseolus vulgaris] gi|561009521|gb|ESW08428.1| hypothetical protein PHAVU_009G045000g [Phaseolus vulgaris] Length = 581 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 YDKKVRYQSRKRLAEQRPRVKGQFVRQVLAD 95 Y+KKVRY+SRK+LAEQRPRVKGQFVRQVL D Sbjct: 527 YEKKVRYESRKKLAEQRPRVKGQFVRQVLPD 557