BLASTX nr result
ID: Akebia27_contig00013197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00013197 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN53673.1| DUF821 [Linum usitatissimum] 74 2e-11 emb|CAN70836.1| hypothetical protein VITISV_015872 [Vitis vinifera] 74 2e-11 ref|XP_006350920.1| PREDICTED: uncharacterized protein LOC102588... 73 5e-11 ref|XP_004242062.1| PREDICTED: uncharacterized protein LOC101246... 72 6e-11 ref|XP_002525649.1| conserved hypothetical protein [Ricinus comm... 72 8e-11 ref|XP_002892388.1| hypothetical protein ARALYDRAFT_887933 [Arab... 71 2e-10 ref|XP_003632132.1| PREDICTED: protein O-glucosyltransferase 1-l... 70 2e-10 ref|XP_004167091.1| PREDICTED: uncharacterized protein LOC101228... 70 4e-10 ref|XP_004153209.1| PREDICTED: uncharacterized protein LOC101204... 70 4e-10 ref|XP_004145318.1| PREDICTED: uncharacterized protein LOC101204... 70 4e-10 ref|XP_004500267.1| PREDICTED: uncharacterized protein LOC101501... 69 5e-10 ref|XP_007016099.1| F10K1.7 protein [Theobroma cacao] gi|5087864... 68 1e-09 ref|XP_003539326.2| PREDICTED: O-glucosyltransferase rumi-like [... 67 3e-09 ref|XP_002299807.2| hypothetical protein POPTR_0001s25900g [Popu... 67 3e-09 ref|XP_007146770.1| hypothetical protein PHAVU_006G068300g [Phas... 66 4e-09 ref|XP_006417825.1| hypothetical protein EUTSA_v10007804mg [Eutr... 66 4e-09 ref|XP_006307276.1| hypothetical protein CARUB_v10008891mg [Caps... 66 4e-09 ref|NP_172202.1| uncharacterized protein [Arabidopsis thaliana] ... 65 1e-08 ref|XP_003552954.1| PREDICTED: O-glucosyltransferase rumi-like [... 65 1e-08 dbj|BAD94602.1| hypothetical protein [Arabidopsis thaliana] 65 1e-08 >gb|AFN53673.1| DUF821 [Linum usitatissimum] Length = 474 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLSRALYTTPNQ 367 ++ TKTI GHNLEP PWH FP K FD+ T++T+A K I+CSYLSC T P Q Sbjct: 38 ATNTKTIAGHNLEPTPWHVFPAKNFDDETRHTRAYKIIQCSYLSCPYFNRTITEPPQ 94 >emb|CAN70836.1| hypothetical protein VITISV_015872 [Vitis vinifera] Length = 922 Score = 74.3 bits (181), Expect = 2e-11 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 +SQTKT+VGHNL P PWH FPPK F E T+YT+ K I+CSYL+C Sbjct: 494 ASQTKTVVGHNLNPTPWHLFPPKTFTEKTRYTRVSKIIQCSYLTC 538 >ref|XP_006350920.1| PREDICTED: uncharacterized protein LOC102588367 [Solanum tuberosum] Length = 463 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLSRALYTTP 361 SQTKTIVGHNLEP PWH FP K FDE + Y+KA I+CSYL+C + + P Sbjct: 39 SQTKTIVGHNLEPTPWHVFPAKSFDEESTYSKASTIIQCSYLTCSSNSHVTNIP 92 >ref|XP_004242062.1| PREDICTED: uncharacterized protein LOC101246258 [Solanum lycopersicum] Length = 463 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLSRALYTTP 361 SQTKTIVGHNLEP PWH FP K FD+ + Y+KA I+CSYL+C S + P Sbjct: 39 SQTKTIVGHNLEPTPWHIFPAKSFDDESTYSKASTIIQCSYLTCSSSSHVVDIP 92 >ref|XP_002525649.1| conserved hypothetical protein [Ricinus communis] gi|223535085|gb|EEF36767.1| conserved hypothetical protein [Ricinus communis] Length = 491 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/67 (47%), Positives = 45/67 (67%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLSRALYTTPNQQQD 376 +S+TKT+ GHNL+P PWH FPP+ FDE T+ +A K I+CSYL+C + TT + Q Sbjct: 38 ASRTKTVAGHNLDPTPWHIFPPRTFDEETRQARAYKIIQCSYLTCPYTNTT-TTRRRSQS 96 Query: 377 VNQFSNK 397 +Q + K Sbjct: 97 SSQANAK 103 >ref|XP_002892388.1| hypothetical protein ARALYDRAFT_887933 [Arabidopsis lyrata subsp. lyrata] gi|297338230|gb|EFH68647.1| hypothetical protein ARALYDRAFT_887933 [Arabidopsis lyrata subsp. lyrata] Length = 508 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/61 (47%), Positives = 41/61 (67%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLSRALYTTPNQQQDV 379 +QTKT+ GHNLEP PWH FP K F EGTK+++A + ++CSY SC + + Q + V Sbjct: 47 AQTKTLAGHNLEPTPWHIFPRKSFSEGTKHSQAYRILQCSYFSCPYNAVVQPKSLQSESV 106 Query: 380 N 382 + Sbjct: 107 S 107 >ref|XP_003632132.1| PREDICTED: protein O-glucosyltransferase 1-like [Vitis vinifera] gi|297745896|emb|CBI15952.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 70.5 bits (171), Expect = 2e-10 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 +SQTKT+VGHNL P PWH FPP F E T+Y + K I+CSYL+C Sbjct: 36 ASQTKTVVGHNLNPTPWHLFPPNTFTEKTRYARVSKIIQCSYLTC 80 >ref|XP_004167091.1| PREDICTED: uncharacterized protein LOC101228589 [Cucumis sativus] Length = 472 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 ++QTKT+ GHNL+P PWH FPPK F + T++ +A+K I CSYL+C Sbjct: 35 AAQTKTVAGHNLDPTPWHLFPPKTFSDETRHARAVKIIHCSYLTC 79 >ref|XP_004153209.1| PREDICTED: uncharacterized protein LOC101204904 [Cucumis sativus] Length = 472 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 ++QTKT+ GHNL+P PWH FPPK F + T++ +A+K I CSYL+C Sbjct: 35 AAQTKTVAGHNLDPTPWHLFPPKTFSDETRHARAVKIIHCSYLTC 79 >ref|XP_004145318.1| PREDICTED: uncharacterized protein LOC101204476 [Cucumis sativus] Length = 472 Score = 69.7 bits (169), Expect = 4e-10 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +2 Query: 197 SSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 ++QTKT+ GHNL+P PWH FPPK F + T++ +A+K I CSYL+C Sbjct: 35 AAQTKTVAGHNLDPTPWHLFPPKTFSDETRHARAVKIIHCSYLTC 79 >ref|XP_004500267.1| PREDICTED: uncharacterized protein LOC101501069 [Cicer arietinum] Length = 466 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +2 Query: 194 ISSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 ++S+T T+VGHNLEP PWH FP K FDE T+ +A K I+CSYL+C Sbjct: 38 VASRTGTVVGHNLEPTPWHVFPAKPFDEETRQRRAYKIIQCSYLTC 83 >ref|XP_007016099.1| F10K1.7 protein [Theobroma cacao] gi|508786462|gb|EOY33718.1| F10K1.7 protein [Theobroma cacao] Length = 508 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/70 (47%), Positives = 43/70 (61%) Frame = +2 Query: 122 LSFSIVVQDSLSTPSLXXXXXXXXISSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKAL 301 L +S+V LS +L +SQTKT+ GHNLEP PWH FP K+F T+ +A Sbjct: 17 LFYSVVALSFLSLAALLIYKVDD-FASQTKTVAGHNLEPTPWHIFPAKKFTGETRQARAY 75 Query: 302 KFIKCSYLSC 331 K I+CSYL+C Sbjct: 76 KIIQCSYLTC 85 >ref|XP_003539326.2| PREDICTED: O-glucosyltransferase rumi-like [Glycine max] Length = 496 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +2 Query: 194 ISSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 ++S+T T+VGHNLEP PWH FP K FDE ++ +A K ++CSYL+C Sbjct: 70 VASRTGTVVGHNLEPTPWHVFPHKPFDEESRQQRAYKILQCSYLTC 115 >ref|XP_002299807.2| hypothetical protein POPTR_0001s25900g [Populus trichocarpa] gi|550348193|gb|EEE84612.2| hypothetical protein POPTR_0001s25900g [Populus trichocarpa] Length = 462 Score = 66.6 bits (161), Expect = 3e-09 Identities = 25/49 (51%), Positives = 36/49 (73%) Frame = +2 Query: 194 ISSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLS 340 ++ QTKT+ GHNL P PWH FPPK FD+ +++ +A + + CSYL+C S Sbjct: 9 LALQTKTVAGHNLPPTPWHLFPPKNFDDQSRHARAYQILHCSYLTCPYS 57 >ref|XP_007146770.1| hypothetical protein PHAVU_006G068300g [Phaseolus vulgaris] gi|561019993|gb|ESW18764.1| hypothetical protein PHAVU_006G068300g [Phaseolus vulgaris] Length = 469 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = +2 Query: 194 ISSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSCGLSRA 346 + S+T T+VGHNLEP PWH FP K FDE T+ +A + ++CSYL+C + A Sbjct: 43 VVSRTGTVVGHNLEPTPWHVFPHKPFDEETRQQRAYRILQCSYLTCRYAAA 93 >ref|XP_006417825.1| hypothetical protein EUTSA_v10007804mg [Eutrema salsugineum] gi|557095596|gb|ESQ36178.1| hypothetical protein EUTSA_v10007804mg [Eutrema salsugineum] Length = 399 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 +QTKT+ GHNLEP PWH FP K F+E TK ++A + ++CSY SC Sbjct: 46 AQTKTLAGHNLEPTPWHIFPRKSFNEATKRSQAYRILQCSYFSC 89 >ref|XP_006307276.1| hypothetical protein CARUB_v10008891mg [Capsella rubella] gi|482575987|gb|EOA40174.1| hypothetical protein CARUB_v10008891mg [Capsella rubella] Length = 509 Score = 66.2 bits (160), Expect = 4e-09 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 +QTKT+ GHNLEP PWH FP K F E T++++A + ++CSY SC Sbjct: 46 AQTKTLAGHNLEPTPWHIFPRKSFSEATRHSQAYRILQCSYFSC 89 >ref|NP_172202.1| uncharacterized protein [Arabidopsis thaliana] gi|8954024|gb|AAF82198.1|AC067971_6 Contains similarity to an unknown protein T2J13.180 gi|6522568 from Arabidopsis thaliana BAC T2J13 gb|AL132967. ESTs gb|Z29835 and gb|Z29836 come from this gene [Arabidopsis thaliana] gi|332189973|gb|AEE28094.1| uncharacterized protein AT1G07220 [Arabidopsis thaliana] gi|591402476|gb|AHL38965.1| glycosyltransferase, partial [Arabidopsis thaliana] Length = 507 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 +QTKT+ GHNLEP PWH FP K F TK+++A + ++CSY SC Sbjct: 46 AQTKTLAGHNLEPTPWHIFPRKSFSAATKHSQAYRILQCSYFSC 89 >ref|XP_003552954.1| PREDICTED: O-glucosyltransferase rumi-like [Glycine max] Length = 464 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +2 Query: 194 ISSQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 ++S+T T+VGHNLEP PWH FP K FDE ++ + K ++CSYL+C Sbjct: 38 VASRTGTVVGHNLEPTPWHVFPHKPFDEESRQQRTYKILQCSYLTC 83 >dbj|BAD94602.1| hypothetical protein [Arabidopsis thaliana] Length = 507 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 200 SQTKTIVGHNLEPPPWHKFPPKQFDEGTKYTKALKFIKCSYLSC 331 +QTKT+ GHNLEP PWH FP K F TK+++A + ++CSY SC Sbjct: 46 AQTKTLAGHNLEPTPWHIFPRKSFSAATKHSQAYRILQCSYFSC 89