BLASTX nr result
ID: Akebia27_contig00012490
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00012490 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi inter... 129 6e-28 ref|XP_004150658.1| PREDICTED: endoplasmic reticulum-Golgi inter... 127 2e-27 ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prun... 126 3e-27 ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate com... 124 1e-26 ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi inter... 124 2e-26 ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi inter... 123 2e-26 ref|XP_003542443.1| PREDICTED: endoplasmic reticulum-Golgi inter... 122 4e-26 ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate com... 122 4e-26 gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis] 122 5e-26 ref|XP_002302286.1| hypothetical protein POPTR_0002s09500g [Popu... 121 1e-25 ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi inter... 120 2e-25 ref|XP_007018816.1| Endoplasmic reticulum vesicle transporter pr... 120 2e-25 ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi inter... 120 2e-25 ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Popu... 120 2e-25 gb|EYU23218.1| hypothetical protein MIMGU_mgv1a007992mg [Mimulus... 120 3e-25 ref|XP_006403044.1| hypothetical protein EUTSA_v10003455mg [Eutr... 119 6e-25 ref|XP_006305051.1| hypothetical protein CARUB_v10009417mg [Caps... 119 6e-25 ref|NP_001154394.1| Endoplasmic reticulum vesicle transporter pr... 119 6e-25 ref|XP_002891208.1| hypothetical protein ARALYDRAFT_891247 [Arab... 119 6e-25 ref|NP_564467.5| Endoplasmic reticulum vesicle transporter prote... 119 6e-25 >ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3 [Vitis vinifera] gi|302141938|emb|CBI19141.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 129 bits (323), Expect = 6e-28 Identities = 65/71 (91%), Positives = 69/71 (97%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D +IN+LRNLDAYPKINEDFYSRTLSGGVITLAS+I MLLLFISELRLYLHAVTETKLVV Sbjct: 2 DNIINKLRNLDAYPKINEDFYSRTLSGGVITLASSIFMLLLFISELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_004150658.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cucumis sativus] gi|449518819|ref|XP_004166433.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cucumis sativus] Length = 386 Score = 127 bits (319), Expect = 2e-27 Identities = 64/71 (90%), Positives = 70/71 (98%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D +I++LRNLDAYPKINEDFYSRTLSGGVITL+S+ILMLLLFISELRLYLHAVTETKLVV Sbjct: 2 DNIISKLRNLDAYPKINEDFYSRTLSGGVITLSSSILMLLLFISELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica] gi|462424423|gb|EMJ28686.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica] Length = 386 Score = 126 bits (317), Expect = 3e-27 Identities = 63/71 (88%), Positives = 70/71 (98%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 + M++RLRNLDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF+SELRLYLHAVTETKLVV Sbjct: 2 ENMMSRLRNLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFLSELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] gi|223546982|gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] Length = 386 Score = 124 bits (312), Expect = 1e-26 Identities = 62/69 (89%), Positives = 68/69 (98%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++N+LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLFISELRLY+HAVTETKL VDT Sbjct: 4 IMNKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFISELRLYIHAVTETKLAVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72 >ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cicer arietinum] Length = 386 Score = 124 bits (310), Expect = 2e-26 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLF SELRLYLHA TETKL+V Sbjct: 2 DSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSELRLYLHAATETKLIV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 123 bits (309), Expect = 2e-26 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLF SELRLYLHAVTETKLVV Sbjct: 2 DSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSR ETLRI+ Sbjct: 62 DTSRAETLRIN 72 >ref|XP_003542443.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 122 bits (307), Expect = 4e-26 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 + +I++LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLF SELRLYLHAVTETKLVV Sbjct: 2 ESIISKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFYSELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSR ETLRI+ Sbjct: 62 DTSRAETLRIN 72 >ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] gi|355516359|gb|AES97982.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] Length = 386 Score = 122 bits (307), Expect = 4e-26 Identities = 60/71 (84%), Positives = 67/71 (94%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D ++N+LRNLDAYPKINEDFYSRTLSGG+IT+ S+ILMLLLF SELRLYLHA TETKLVV Sbjct: 2 DSIMNKLRNLDAYPKINEDFYSRTLSGGLITIVSSILMLLLFFSELRLYLHAATETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis] Length = 386 Score = 122 bits (306), Expect = 5e-26 Identities = 60/71 (84%), Positives = 70/71 (98%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 + ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF+SELRLYLHAVTET+LVV Sbjct: 2 ENVMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFLSELRLYLHAVTETQLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_002302286.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa] gi|222844012|gb|EEE81559.1| hypothetical protein POPTR_0002s09500g [Populus trichocarpa] Length = 377 Score = 121 bits (303), Expect = 1e-25 Identities = 60/71 (84%), Positives = 67/71 (94%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D ++++LRN DAYPKINEDFYSRTLSGGVITLAS+I+M LLF SELRLYLHAVTETKLVV Sbjct: 2 DGLMSKLRNFDAYPKINEDFYSRTLSGGVITLASSIVMFLLFFSELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Solanum tuberosum] Length = 386 Score = 120 bits (302), Expect = 2e-25 Identities = 59/71 (83%), Positives = 67/71 (94%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D I+++R+LDAYPKINEDFYSRTLSGGVITLAS+I+M LLFISELRLYLHA TETKL+V Sbjct: 2 DSFISKIRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAATETKLIV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_007018816.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma cacao] gi|508724144|gb|EOY16041.1| Endoplasmic reticulum vesicle transporter protein isoform 1 [Theobroma cacao] Length = 386 Score = 120 bits (302), Expect = 2e-25 Identities = 59/71 (83%), Positives = 66/71 (92%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D ++N+LRNLDAYPKINEDFYSRTLSGGVITL S+++M LF SELRLYLHAVTETKLVV Sbjct: 2 DGIMNKLRNLDAYPKINEDFYSRTLSGGVITLVSSVVMFFLFFSELRLYLHAVTETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Solanum lycopersicum] Length = 386 Score = 120 bits (302), Expect = 2e-25 Identities = 59/71 (83%), Positives = 67/71 (94%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 D ++++R+LDAYPKINEDFYSRTLSGGVITLAS+I+M LLFISELRLYLHA TETKLVV Sbjct: 2 DSFVSKIRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISELRLYLHAATETKLVV 61 Query: 270 DTSRGETLRIH 302 DTSRGETLRI+ Sbjct: 62 DTSRGETLRIN 72 >ref|XP_002306582.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa] gi|222856031|gb|EEE93578.1| hypothetical protein POPTR_0005s16700g [Populus trichocarpa] Length = 386 Score = 120 bits (302), Expect = 2e-25 Identities = 59/69 (85%), Positives = 67/69 (97%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+++M LLF SELRLYLHAVTETKLVVDT Sbjct: 4 LMSKLRNLDAYPKINEDFYSRTLSGGVITLASSVVMFLLFFSELRLYLHAVTETKLVVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72 >gb|EYU23218.1| hypothetical protein MIMGU_mgv1a007992mg [Mimulus guttatus] Length = 388 Score = 120 bits (300), Expect = 3e-25 Identities = 60/71 (84%), Positives = 68/71 (95%) Frame = +3 Query: 90 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVV 269 + +I +LR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLFISELRLYLH+VTETKLVV Sbjct: 4 ESIIGKLRSLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFISELRLYLHSVTETKLVV 63 Query: 270 DTSRGETLRIH 302 DTSRGE LRI+ Sbjct: 64 DTSRGERLRIN 74 >ref|XP_006403044.1| hypothetical protein EUTSA_v10003455mg [Eutrema salsugineum] gi|557104151|gb|ESQ44497.1| hypothetical protein EUTSA_v10003455mg [Eutrema salsugineum] Length = 386 Score = 119 bits (297), Expect = 6e-25 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++N+LRNLDAYPKINEDFYSRTLSGGVITL S+++M LLF SELRLYLH VTETKLVVDT Sbjct: 4 ILNKLRNLDAYPKINEDFYSRTLSGGVITLFSSVVMFLLFFSELRLYLHTVTETKLVVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72 >ref|XP_006305051.1| hypothetical protein CARUB_v10009417mg [Capsella rubella] gi|482573762|gb|EOA37949.1| hypothetical protein CARUB_v10009417mg [Capsella rubella] Length = 386 Score = 119 bits (297), Expect = 6e-25 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++N+LRNLDAYPKINEDFYSRTLSGGVITL S+++M LLF SELRLYLH VTETKL+VDT Sbjct: 4 ILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72 >ref|NP_001154394.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] gi|12324714|gb|AAG52317.1|AC021666_6 unknown protein; 24499-21911 [Arabidopsis thaliana] gi|27808598|gb|AAO24579.1| At1g36050 [Arabidopsis thaliana] gi|110736190|dbj|BAF00066.1| hypothetical protein [Arabidopsis thaliana] gi|332193720|gb|AEE31841.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] Length = 386 Score = 119 bits (297), Expect = 6e-25 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++N+LRNLDAYPKINEDFYSRTLSGGVITL S+++M LLF SELRLYLH VTETKL+VDT Sbjct: 4 ILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72 >ref|XP_002891208.1| hypothetical protein ARALYDRAFT_891247 [Arabidopsis lyrata subsp. lyrata] gi|297337050|gb|EFH67467.1| hypothetical protein ARALYDRAFT_891247 [Arabidopsis lyrata subsp. lyrata] Length = 386 Score = 119 bits (297), Expect = 6e-25 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++N+LRNLDAYPKINEDFYSRTLSGGVITL S+++M LLF SELRLYLH VTETKL+VDT Sbjct: 4 ILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72 >ref|NP_564467.5| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] gi|332193719|gb|AEE31840.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] Length = 489 Score = 119 bits (297), Expect = 6e-25 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = +3 Query: 96 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISELRLYLHAVTETKLVVDT 275 ++N+LRNLDAYPKINEDFYSRTLSGGVITL S+++M LLF SELRLYLH VTETKL+VDT Sbjct: 4 ILNKLRNLDAYPKINEDFYSRTLSGGVITLLSSVVMFLLFFSELRLYLHTVTETKLIVDT 63 Query: 276 SRGETLRIH 302 SRGETLRI+ Sbjct: 64 SRGETLRIN 72