BLASTX nr result
ID: Akebia27_contig00012462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00012462 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270129.1| PREDICTED: U1 small nuclear ribonucleoprotei... 59 9e-07 ref|XP_004287907.1| PREDICTED: U1 small nuclear ribonucleoprotei... 55 8e-06 >ref|XP_002270129.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Vitis vinifera] Length = 514 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/51 (47%), Positives = 38/51 (74%) Frame = -3 Query: 339 SEMDHDRYDHVEPEGLRYSRAISDSREREKTQDREWDYQRSERSISREYEH 187 ++ D DRY+ ++ + Y A DSRER++T+D E +Y+RSERS+SR++EH Sbjct: 464 ADNDRDRYNQMDEDNYHYDHAAYDSRERDRTRDLEREYRRSERSLSRDFEH 514 >ref|XP_004287907.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like [Fragaria vesca subsp. vesca] Length = 509 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = -3 Query: 339 SEMDHDRY--------DHVEPEGLRYSRAISDSREREKTQDREWDYQRSERSISREYEH 187 +E DHDRY D +E + Y +A +SRERE++ D + DYQRS RSISREYE+ Sbjct: 451 TEHDHDRYKQYPDRYDDRMEEDDYHYEKAPVESRERERSGDVDRDYQRSARSISREYEY 509