BLASTX nr result
ID: Akebia27_contig00012390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00012390 (505 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214850.1| hypothetical protein PRUPE_ppa006690mg [Prun... 60 2e-07 ref|XP_002518574.1| transcription regulator, putative [Ricinus c... 58 1e-06 ref|XP_004155594.1| PREDICTED: mediator-associated protein 1-lik... 58 2e-06 ref|XP_002300270.1| hypothetical protein POPTR_0001s30110g [Popu... 57 2e-06 >ref|XP_007214850.1| hypothetical protein PRUPE_ppa006690mg [Prunus persica] gi|462411000|gb|EMJ16049.1| hypothetical protein PRUPE_ppa006690mg [Prunus persica] Length = 399 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/51 (56%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +2 Query: 356 KRSKGDPKRPFRRFWSEDDEVVILKGMIDF-IKKGHEPFSNTDAFLDFIKK 505 K D K+ F+R WS+DDE+ ILKGMID+ KKG +P+S+ AF DFIKK Sbjct: 162 KAGGDDSKKLFQRIWSDDDEITILKGMIDYSTKKGADPYSDMGAFHDFIKK 212 >ref|XP_002518574.1| transcription regulator, putative [Ricinus communis] gi|223542419|gb|EEF43961.1| transcription regulator, putative [Ricinus communis] Length = 391 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/53 (50%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +2 Query: 350 SVKRSKGDPKRPFRRFWSEDDEVVILKGMIDFI-KKGHEPFSNTDAFLDFIKK 505 + ++S+ K+ F+R WSEDDE+V+LKG+IDFI KKG +P + +F D+IKK Sbjct: 156 TAEKSEDTKKQLFQRLWSEDDEIVVLKGIIDFIEKKGVDPAKDIISFFDYIKK 208 >ref|XP_004155594.1| PREDICTED: mediator-associated protein 1-like [Cucumis sativus] Length = 414 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = +2 Query: 356 KRSKGDPKRPFRRFWSEDDEVVILKGMIDF-IKKGHEPFSNTDAFLDFIKK 505 K+S + K+ F+R WSEDDE+ IL GMID+ KKG +P + +AF DFIKK Sbjct: 172 KKSVDESKKLFQRLWSEDDEIAILNGMIDYSAKKGSDPSLDMNAFHDFIKK 222 >ref|XP_002300270.1| hypothetical protein POPTR_0001s30110g [Populus trichocarpa] gi|222847528|gb|EEE85075.1| hypothetical protein POPTR_0001s30110g [Populus trichocarpa] Length = 380 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 8/58 (13%) Frame = +2 Query: 356 KRSKGDPKRP-------FRRFWSEDDEVVILKGMIDF-IKKGHEPFSNTDAFLDFIKK 505 K + DP++P F+R W+EDDE+ +L+G+IDF KKG++P + +AF DFIKK Sbjct: 141 KNKEPDPEKPEDSKKQLFQRLWTEDDEIALLRGIIDFTAKKGYDPSKDMNAFYDFIKK 198