BLASTX nr result
ID: Akebia27_contig00011485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00011485 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB54574.1| glucose-repressible protein [Colletotrichum gloeo... 55 8e-06 >gb|EQB54574.1| glucose-repressible protein [Colletotrichum gloeosporioides Cg-14] Length = 71 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/63 (47%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = +3 Query: 48 METINNAANAVSEGVQQAVGAGKQEKGEQQMK-NDSSLTGKAEGAKDYISGAGEKNAHGA 224 M+TI NAAN VSE VQQA +E +Q K ND+SLT +A AKD + ++++H A Sbjct: 1 MDTIKNAANYVSESVQQAGATASKETNKQVAKDNDASLTSRASAAKDAVGDKLDESSHEA 60 Query: 225 KSD 233 K+D Sbjct: 61 KAD 63