BLASTX nr result
ID: Akebia27_contig00011243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00011243 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382008.1| mitochondrial substrate carrier family prote... 64 3e-08 ref|XP_002308549.1| hypothetical protein POPTR_0006s24280g [Popu... 64 3e-08 ref|XP_007012316.1| Mitochondrial substrate carrier family prote... 62 6e-08 ref|XP_007012315.1| Mitochondrial substrate carrier family prote... 62 6e-08 ref|XP_007222493.1| hypothetical protein PRUPE_ppa008235mg [Prun... 62 6e-08 ref|XP_004245079.1| PREDICTED: mitochondrial substrate carrier f... 62 8e-08 ref|XP_002278430.1| PREDICTED: graves disease carrier protein is... 62 8e-08 ref|XP_002278410.1| PREDICTED: graves disease carrier protein is... 62 8e-08 emb|CAN83681.1| hypothetical protein VITISV_003846 [Vitis vinifera] 62 8e-08 ref|XP_006475897.1| PREDICTED: mitochondrial substrate carrier f... 61 1e-07 ref|XP_002516087.1| Grave disease carrier protein, putative [Ric... 61 1e-07 ref|XP_006450869.1| hypothetical protein CICLE_v10008822mg [Citr... 61 2e-07 ref|XP_004291057.1| PREDICTED: graves disease carrier protein-li... 59 5e-07 gb|AAF63166.1|AC010657_2 T5E21.6 [Arabidopsis thaliana] 58 1e-06 ref|NP_172908.1| mitochondrial CoA transporter [Arabidopsis thal... 58 1e-06 gb|AAM13060.1| putative mitochondrial carrier protein [Arabidops... 58 1e-06 ref|XP_006305322.1| hypothetical protein CARUB_v10009700mg [Caps... 58 2e-06 ref|XP_002890063.1| mitochondrial substrate carrier family prote... 57 3e-06 gb|EXB66845.1| Mitochondrial substrate carrier family protein B ... 57 4e-06 ref|XP_004501458.1| PREDICTED: mitochondrial substrate carrier f... 57 4e-06 >ref|XP_006382008.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550336984|gb|ERP59805.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 343 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP QG+ YR+T +GLS IVRNQG+KQLFAGLSINY+K+ Sbjct: 267 QVENLQP-LSQGNARYRNTFEGLSTIVRNQGWKQLFAGLSINYIKI 311 >ref|XP_002308549.1| hypothetical protein POPTR_0006s24280g [Populus trichocarpa] gi|222854525|gb|EEE92072.1| hypothetical protein POPTR_0006s24280g [Populus trichocarpa] Length = 340 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP QG+ YR+T +GLS IVRNQG+KQLFAGLSINY+K+ Sbjct: 264 QVENLQP-LSQGNARYRNTFEGLSTIVRNQGWKQLFAGLSINYIKI 308 >ref|XP_007012316.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] gi|508782679|gb|EOY29935.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] Length = 322 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV+SLQ S QG YR+T++GL+ IVRNQG++QLFAGLSINY+KV Sbjct: 268 QVESLQCSTIQGGRRYRNTIEGLTTIVRNQGWRQLFAGLSINYIKV 313 >ref|XP_007012315.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] gi|508782678|gb|EOY29934.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] Length = 345 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV+SLQ S QG YR+T++GL+ IVRNQG++QLFAGLSINY+KV Sbjct: 268 QVESLQCSTIQGGRRYRNTIEGLTTIVRNQGWRQLFAGLSINYIKV 313 >ref|XP_007222493.1| hypothetical protein PRUPE_ppa008235mg [Prunus persica] gi|462419429|gb|EMJ23692.1| hypothetical protein PRUPE_ppa008235mg [Prunus persica] Length = 340 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/46 (63%), Positives = 41/46 (89%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQPS QG Y++T++GL+YIVRNQG+K+LF+GLSINY+K+ Sbjct: 268 QVENLQPS-GQGGVRYKNTLEGLTYIVRNQGWKKLFSGLSINYIKI 312 >ref|XP_004245079.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Solanum lycopersicum] Length = 343 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV+ L+PS Q YRST DGLS IVRNQG++QLFAGLS+NYMK+ Sbjct: 267 QVEHLRPSLQDR-ARYRSTFDGLSSIVRNQGWRQLFAGLSVNYMKI 311 >ref|XP_002278430.1| PREDICTED: graves disease carrier protein isoform 2 [Vitis vinifera] Length = 335 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQPS Q G+ YR+T++GL+ I RNQG++QLFAGLSINY+K+ Sbjct: 259 QVENLQPSIQ-GNARYRNTLEGLATITRNQGWRQLFAGLSINYIKI 303 >ref|XP_002278410.1| PREDICTED: graves disease carrier protein isoform 1 [Vitis vinifera] gi|296081639|emb|CBI20644.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQPS Q G+ YR+T++GL+ I RNQG++QLFAGLSINY+K+ Sbjct: 268 QVENLQPSIQ-GNARYRNTLEGLATITRNQGWRQLFAGLSINYIKI 312 >emb|CAN83681.1| hypothetical protein VITISV_003846 [Vitis vinifera] Length = 344 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/46 (63%), Positives = 40/46 (86%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQPS Q G+ YR+T++GL+ I RNQG++QLFAGLSINY+K+ Sbjct: 268 QVENLQPSIQ-GNARYRNTLEGLATITRNQGWRQLFAGLSINYIKI 312 >ref|XP_006475897.1| PREDICTED: mitochondrial substrate carrier family protein B-like [Citrus sinensis] Length = 345 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV+ ++P + GD YR+T +GL+ IVRNQG+KQLFAGLSINY+K+ Sbjct: 268 QVEYMKPLSKGGDVRYRNTFEGLAAIVRNQGWKQLFAGLSINYIKI 313 >ref|XP_002516087.1| Grave disease carrier protein, putative [Ricinus communis] gi|223544573|gb|EEF46089.1| Grave disease carrier protein, putative [Ricinus communis] Length = 344 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQPS Q G YR+T DGLS IVR QG++QLFAGLSINY+K+ Sbjct: 268 QVENLQPSVQ-GHGRYRNTWDGLSTIVRKQGWRQLFAGLSINYIKI 312 >ref|XP_006450869.1| hypothetical protein CICLE_v10008822mg [Citrus clementina] gi|557554095|gb|ESR64109.1| hypothetical protein CICLE_v10008822mg [Citrus clementina] Length = 345 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV+ + P + GD YR+T +GL+ IVRNQG+KQLFAGLSINY+K+ Sbjct: 268 QVEYMNPLSKGGDVRYRNTFEGLAAIVRNQGWKQLFAGLSINYIKI 313 >ref|XP_004291057.1| PREDICTED: graves disease carrier protein-like [Fragaria vesca subsp. vesca] Length = 343 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQPS G Y++TM GL YI+RNQG+++LFAGLSINY+K+ Sbjct: 269 QVENLQPS---GGVKYKNTMHGLKYIIRNQGWQKLFAGLSINYIKI 311 >gb|AAF63166.1|AC010657_2 T5E21.6 [Arabidopsis thaliana] Length = 319 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 325 QVQSLQPSFQQGD-PGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP +G+ Y++T DGL+ IVR QG+KQLFAGLSINY+K+ Sbjct: 244 QVENLQPMTSEGNNKRYKNTFDGLNTIVRTQGWKQLFAGLSINYIKI 290 >ref|NP_172908.1| mitochondrial CoA transporter [Arabidopsis thaliana] gi|332191060|gb|AEE29181.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] Length = 331 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 325 QVQSLQPSFQQGD-PGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP +G+ Y++T DGL+ IVR QG+KQLFAGLSINY+K+ Sbjct: 256 QVENLQPMTSEGNNKRYKNTFDGLNTIVRTQGWKQLFAGLSINYIKI 302 >gb|AAM13060.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|22136184|gb|AAM91170.1| putative mitochondrial carrier protein [Arabidopsis thaliana] Length = 152 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 325 QVQSLQPSFQQGD-PGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP +G+ Y++T DGL+ IVR QG+KQLFAGLSINY+K+ Sbjct: 77 QVENLQPMTSEGNNKRYKNTFDGLNTIVRTQGWKQLFAGLSINYIKI 123 >ref|XP_006305322.1| hypothetical protein CARUB_v10009700mg [Capsella rubella] gi|482574033|gb|EOA38220.1| hypothetical protein CARUB_v10009700mg [Capsella rubella] Length = 331 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 325 QVQSLQPSFQQGD-PGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP +G+ Y++T DGLS IVR QG++QLFAGLSINY+K+ Sbjct: 256 QVENLQPITSEGNNKRYKNTFDGLSTIVRTQGWRQLFAGLSINYIKI 302 >ref|XP_002890063.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297335905|gb|EFH66322.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 331 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/47 (57%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -1 Query: 325 QVQSLQPSFQQGD-PGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QV++LQP +G+ Y++T DGL+ IVR QG++QLFAGLSINY+K+ Sbjct: 256 QVENLQPMTSEGNNKRYKNTFDGLNTIVRTQGWRQLFAGLSINYIKI 302 >gb|EXB66845.1| Mitochondrial substrate carrier family protein B [Morus notabilis] Length = 337 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = -1 Query: 295 QGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKV 188 QGD G+++T +GL+ IVRNQG++QLFAGLSINY+K+ Sbjct: 270 QGDGGFKNTWEGLTTIVRNQGWRQLFAGLSINYIKI 305 >ref|XP_004501458.1| PREDICTED: mitochondrial substrate carrier family protein B-like isoform X1 [Cicer arietinum] Length = 346 Score = 56.6 bits (135), Expect = 4e-06 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = -1 Query: 325 QVQSLQPSFQQGDPGYRSTMDGLSYIVRNQGYKQLFAGLSINYMKVGSMLNQARISTY 152 QV SLQ + GD YR+T DGL IV+NQG++QLFAG+SINY++V ML + I Y Sbjct: 267 QVGSLQKA-DHGDARYRNTFDGLRKIVQNQGWRQLFAGVSINYIRV--MLTLSYIQLY 321