BLASTX nr result
ID: Akebia27_contig00011231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00011231 (1190 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855408.1| hypothetical protein AMTR_s00057p00152610 [A... 79 4e-12 ref|XP_002314403.2| hypothetical protein POPTR_0010s03250g [Popu... 70 2e-09 ref|XP_006380028.1| hypothetical protein POPTR_0008s19980g [Popu... 64 1e-07 emb|CBI26119.3| unnamed protein product [Vitis vinifera] 59 5e-06 ref|XP_002312711.2| hypothetical protein POPTR_0008s19980g [Popu... 58 7e-06 >ref|XP_006855408.1| hypothetical protein AMTR_s00057p00152610 [Amborella trichopoda] gi|548859174|gb|ERN16875.1| hypothetical protein AMTR_s00057p00152610 [Amborella trichopoda] Length = 446 Score = 79.0 bits (193), Expect = 4e-12 Identities = 39/82 (47%), Positives = 49/82 (59%), Gaps = 12/82 (14%) Frame = -3 Query: 1185 DAYVLPAVRKPDHILAQSLELCLGNSGGYPLA------------KNFSKPELSVDTASMG 1042 D P RKPD +LAQS ELCLG SGGY +F++P +SVD MG Sbjct: 353 DLCAFPVTRKPDQLLAQSSELCLGLSGGYSSVMGAFPGQLQDNNNDFARPAMSVDANPMG 412 Query: 1041 VMRNKYLQTAYSFPGNSGSLLT 976 +MR +Y+ T YSFPGNSG+ +T Sbjct: 413 IMRTRYISTPYSFPGNSGAAIT 434 >ref|XP_002314403.2| hypothetical protein POPTR_0010s03250g [Populus trichocarpa] gi|550329003|gb|EEF00574.2| hypothetical protein POPTR_0010s03250g [Populus trichocarpa] Length = 392 Score = 70.1 bits (170), Expect = 2e-09 Identities = 37/69 (53%), Positives = 44/69 (63%), Gaps = 5/69 (7%) Frame = -3 Query: 1170 PAVRKPDHILAQSLELCLGNSGGYPLAKNFSKPE-----LSVDTASMGVMRNKYLQTAYS 1006 P+V +PD ILAQS E+CL NSGG P NFS L TAS+G++R+KYL YS Sbjct: 311 PSVHQPDEILAQSSEMCLNNSGGCPPLTNFSNQSPVDNILRPQTASVGMLRSKYLSKPYS 370 Query: 1005 FPGNSGSLL 979 F GNSG L Sbjct: 371 FAGNSGQSL 379 >ref|XP_006380028.1| hypothetical protein POPTR_0008s19980g [Populus trichocarpa] gi|550333506|gb|ERP57825.1| hypothetical protein POPTR_0008s19980g [Populus trichocarpa] Length = 402 Score = 64.3 bits (155), Expect = 1e-07 Identities = 37/81 (45%), Positives = 48/81 (59%), Gaps = 6/81 (7%) Frame = -3 Query: 1170 PAVRKPDHILAQSLELCLGNSGGYPLAKNFSKPELSVD------TASMGVMRNKYLQTAY 1009 P+V +PD IL+QS E C+ SGG P NFS + VD TAS+G++R+KYL Y Sbjct: 313 PSVHQPDQILSQSSETCVDKSGGCPPLTNFSN-QCPVDNIQIPQTASIGMLRSKYLPKPY 371 Query: 1008 SFPGNSGSLLTISIIVSFNYL 946 SF G G LL S + S +L Sbjct: 372 SFAGKPGGLLISSTVTSSMFL 392 >emb|CBI26119.3| unnamed protein product [Vitis vinifera] Length = 410 Score = 58.5 bits (140), Expect = 5e-06 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 5/82 (6%) Frame = -3 Query: 1188 KDAYVLPAVRKPDHILAQSLELCLGNSGGYPLAKNFSKP-----ELSVDTASMGVMRNKY 1024 +D + LP+++ PD +L QS E+ LG S G P A NFS L A +G +++KY Sbjct: 315 RDTHFLPSMQNPDKVLVQSSEVFLGKSEGCPPAMNFSNQVHVNNVLRPHAAPVGTIKSKY 374 Query: 1023 LQTAYSFPGNSGSLLTISIIVS 958 L YSF NSG+ I + S Sbjct: 375 LSKPYSFASNSGNFYLILAVAS 396 >ref|XP_002312711.2| hypothetical protein POPTR_0008s19980g [Populus trichocarpa] gi|550333505|gb|EEE90078.2| hypothetical protein POPTR_0008s19980g [Populus trichocarpa] Length = 394 Score = 58.2 bits (139), Expect = 7e-06 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 6/70 (8%) Frame = -3 Query: 1170 PAVRKPDHILAQSLELCLGNSGGYPLAKNFSKPELSVD------TASMGVMRNKYLQTAY 1009 P+V +PD IL+QS E C+ SGG P NFS + VD TAS+G++R+KYL Y Sbjct: 313 PSVHQPDQILSQSSETCVDKSGGCPPLTNFSN-QCPVDNIQIPQTASIGMLRSKYLPKPY 371 Query: 1008 SFPGNSGSLL 979 SF G G L Sbjct: 372 SFAGKPGQSL 381