BLASTX nr result
ID: Akebia27_contig00010460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00010460 (1388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77480.1| hypothetical protein VITISV_021632 [Vitis vinifera] 47 9e-06 >emb|CAN77480.1| hypothetical protein VITISV_021632 [Vitis vinifera] Length = 2706 Score = 46.6 bits (109), Expect(2) = 9e-06 Identities = 26/71 (36%), Positives = 39/71 (54%) Frame = -3 Query: 297 SSFG*CSKLDNVISRSVIAPNIFDMYMVEGQSIDHVLMHCKPAKQVWFHFLALFGIHACF 118 +++G LD + R PN +Y E ++I+H+L+HC AK +W LAL G+ F Sbjct: 2166 ATWGKVLTLDRLQRRGWHLPNRCFLYGCEEETINHILIHCTVAKGLWNIILALCGVQWVF 2225 Query: 117 PK*FCSLLEGW 85 P S+ EGW Sbjct: 2226 PN---SVKEGW 2233 Score = 31.2 bits (69), Expect(2) = 9e-06 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -2 Query: 346 FPASTIWGPKVPSEISFFIW 287 FP S +W KVP++I+FF W Sbjct: 2145 FPHSNVWVGKVPTKIAFFAW 2164