BLASTX nr result
ID: Akebia27_contig00010324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00010324 (617 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004504860.1| PREDICTED: GATA transcription factor 28-like... 71 2e-10 ref|XP_006583774.1| PREDICTED: GATA transcription factor 28-like... 69 1e-09 ref|XP_007159158.1| hypothetical protein PHAVU_002G213800g [Phas... 69 1e-09 ref|XP_007200769.1| hypothetical protein PRUPE_ppa023830mg [Prun... 69 1e-09 ref|XP_002268872.2| PREDICTED: GATA transcription factor 28-like... 69 1e-09 ref|XP_003532598.1| PREDICTED: GATA transcription factor 24-like... 69 1e-09 emb|CBI38233.3| unnamed protein product [Vitis vinifera] 69 1e-09 ref|XP_007018262.1| ZIM-like 1 isoform 3 [Theobroma cacao] gi|50... 68 2e-09 ref|XP_007018261.1| ZIM-like 1 isoform 2 [Theobroma cacao] gi|50... 68 2e-09 gb|AAK76580.1| putative flowering protein CONSTANS [Arabidopsis ... 68 2e-09 ref|NP_564593.1| GATA transcription factor 28 [Arabidopsis thali... 68 2e-09 ref|XP_002891646.1| hypothetical protein ARALYDRAFT_892135 [Arab... 68 2e-09 ref|XP_006433801.1| hypothetical protein CICLE_v10002056mg [Citr... 67 4e-09 ref|XP_001764510.1| predicted protein [Physcomitrella patens] gi... 67 4e-09 ref|XP_001764623.1| predicted protein [Physcomitrella patens] gi... 67 4e-09 ref|XP_001769163.1| predicted protein [Physcomitrella patens] gi... 67 4e-09 ref|XP_001777746.1| predicted protein [Physcomitrella patens] gi... 67 4e-09 ref|XP_006578295.1| PREDICTED: GATA transcription factor 24-like... 67 5e-09 ref|XP_003522771.1| PREDICTED: GATA transcription factor 24-like... 67 5e-09 ref|XP_006393030.1| hypothetical protein EUTSA_v10011695mg [Eutr... 66 7e-09 >ref|XP_004504860.1| PREDICTED: GATA transcription factor 28-like [Cicer arietinum] Length = 340 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 181 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 211 >ref|XP_006583774.1| PREDICTED: GATA transcription factor 28-like [Glycine max] Length = 355 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GI EKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 197 GISEKSTPAMRRGPAGPRSLCNACGLMWANK 227 >ref|XP_007159158.1| hypothetical protein PHAVU_002G213800g [Phaseolus vulgaris] gi|561032573|gb|ESW31152.1| hypothetical protein PHAVU_002G213800g [Phaseolus vulgaris] Length = 360 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GI EKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 187 GISEKSTPAMRRGPAGPRSLCNACGLMWANK 217 >ref|XP_007200769.1| hypothetical protein PRUPE_ppa023830mg [Prunus persica] gi|462396169|gb|EMJ01968.1| hypothetical protein PRUPE_ppa023830mg [Prunus persica] Length = 277 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GI EKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 203 GISEKSTPAMRRGPAGPRSLCNACGLMWANK 233 >ref|XP_002268872.2| PREDICTED: GATA transcription factor 28-like [Vitis vinifera] Length = 371 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GI EKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 209 GISEKSTPAMRRGPAGPRSLCNACGLMWANK 239 >ref|XP_003532598.1| PREDICTED: GATA transcription factor 24-like [Glycine max] Length = 358 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GI EKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 200 GISEKSTPAMRRGPAGPRSLCNACGLMWANK 230 >emb|CBI38233.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GI EKSTPAMRRGPAGPRSLCNACGLMWANK Sbjct: 26 GISEKSTPAMRRGPAGPRSLCNACGLMWANK 56 >ref|XP_007018262.1| ZIM-like 1 isoform 3 [Theobroma cacao] gi|508723590|gb|EOY15487.1| ZIM-like 1 isoform 3 [Theobroma cacao] Length = 342 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANKVGITVVI*YCASLSSL 141 G+ E +TPAMRRGPAGPR+LCNACGLMWANKV + +V L +L Sbjct: 214 GVSENNTPAMRRGPAGPRTLCNACGLMWANKVCLRIVFGMLLMLGTL 260 >ref|XP_007018261.1| ZIM-like 1 isoform 2 [Theobroma cacao] gi|508723589|gb|EOY15486.1| ZIM-like 1 isoform 2 [Theobroma cacao] Length = 368 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANKVGITVVI*YCASLSSL 141 G+ E +TPAMRRGPAGPR+LCNACGLMWANKV + +V L +L Sbjct: 214 GVSENNTPAMRRGPAGPRTLCNACGLMWANKVCLRIVFGMLLMLGTL 260 >gb|AAK76580.1| putative flowering protein CONSTANS [Arabidopsis thaliana] Length = 302 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGEKSTP MRRGPAGPR+LCNACGLMWANK Sbjct: 227 GIGEKSTPMMRRGPAGPRTLCNACGLMWANK 257 >ref|NP_564593.1| GATA transcription factor 28 [Arabidopsis thaliana] gi|42571823|ref|NP_974002.1| GATA transcription factor 28 [Arabidopsis thaliana] gi|71660840|sp|Q8H1G0.1|GAT28_ARATH RecName: Full=GATA transcription factor 28; AltName: Full=Protein TIFY 2A; AltName: Full=ZIM-like 2 protein gi|23297318|gb|AAN12940.1| putative flowering protein CONSTANS [Arabidopsis thaliana] gi|38603660|dbj|BAD02931.1| GATA-type zinc finger protein [Arabidopsis thaliana] gi|332194567|gb|AEE32688.1| GATA transcription factor 28 [Arabidopsis thaliana] gi|332194568|gb|AEE32689.1| GATA transcription factor 28 [Arabidopsis thaliana] Length = 302 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGEKSTP MRRGPAGPR+LCNACGLMWANK Sbjct: 227 GIGEKSTPMMRRGPAGPRTLCNACGLMWANK 257 >ref|XP_002891646.1| hypothetical protein ARALYDRAFT_892135 [Arabidopsis lyrata subsp. lyrata] gi|297337488|gb|EFH67905.1| hypothetical protein ARALYDRAFT_892135 [Arabidopsis lyrata subsp. lyrata] Length = 302 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGEKSTP MRRGPAGPR+LCNACGLMWANK Sbjct: 228 GIGEKSTPMMRRGPAGPRTLCNACGLMWANK 258 >ref|XP_006433801.1| hypothetical protein CICLE_v10002056mg [Citrus clementina] gi|557535923|gb|ESR47041.1| hypothetical protein CICLE_v10002056mg [Citrus clementina] Length = 238 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANKVGI 102 GI KSTP MRRGP+GPRSLCNACGL WANKVG+ Sbjct: 205 GISSKSTPMMRRGPSGPRSLCNACGLFWANKVGV 238 >ref|XP_001764510.1| predicted protein [Physcomitrella patens] gi|162684374|gb|EDQ70777.1| predicted protein [Physcomitrella patens] Length = 242 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGE+STP MRRGPAGPR+LCNACGLMWANK Sbjct: 201 GIGERSTPMMRRGPAGPRTLCNACGLMWANK 231 >ref|XP_001764623.1| predicted protein [Physcomitrella patens] gi|162684201|gb|EDQ70605.1| predicted protein [Physcomitrella patens] Length = 395 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGE+STP MRRGPAGPR+LCNACGLMWANK Sbjct: 283 GIGERSTPMMRRGPAGPRTLCNACGLMWANK 313 >ref|XP_001769163.1| predicted protein [Physcomitrella patens] gi|162679589|gb|EDQ66035.1| predicted protein [Physcomitrella patens] Length = 380 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGE+STP MRRGPAGPR+LCNACGLMWANK Sbjct: 270 GIGERSTPMMRRGPAGPRTLCNACGLMWANK 300 >ref|XP_001777746.1| predicted protein [Physcomitrella patens] gi|162670847|gb|EDQ57408.1| predicted protein [Physcomitrella patens] Length = 300 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGE+STP MRRGPAGPR+LCNACGLMWANK Sbjct: 237 GIGERSTPMMRRGPAGPRTLCNACGLMWANK 267 >ref|XP_006578295.1| PREDICTED: GATA transcription factor 24-like isoform X2 [Glycine max] Length = 343 Score = 66.6 bits (161), Expect = 5e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 G+GE +TPAMRRGPAGPR+LCNACGLMWANK Sbjct: 197 GVGENNTPAMRRGPAGPRTLCNACGLMWANK 227 >ref|XP_003522771.1| PREDICTED: GATA transcription factor 24-like isoformX1 [Glycine max] Length = 350 Score = 66.6 bits (161), Expect = 5e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 G+GE +TPAMRRGPAGPR+LCNACGLMWANK Sbjct: 204 GVGENNTPAMRRGPAGPRTLCNACGLMWANK 234 >ref|XP_006393030.1| hypothetical protein EUTSA_v10011695mg [Eutrema salsugineum] gi|557089608|gb|ESQ30316.1| hypothetical protein EUTSA_v10011695mg [Eutrema salsugineum] Length = 299 Score = 66.2 bits (160), Expect = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 GIGEKSTPAMRRGPAGPRSLCNACGLMWANK 93 GIGEKSTP MRRGP GPR+LCNACGLMWANK Sbjct: 225 GIGEKSTPMMRRGPEGPRTLCNACGLMWANK 255