BLASTX nr result
ID: Akebia27_contig00009861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00009861 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018507.1| ARM repeat superfamily protein [Theobroma ca... 108 1e-21 ref|XP_006472298.1| PREDICTED: U-box domain-containing protein 4... 106 4e-21 ref|XP_006433633.1| hypothetical protein CICLE_v10001676mg [Citr... 106 4e-21 ref|XP_004142891.1| PREDICTED: U-box domain-containing protein 4... 104 1e-20 ref|XP_002510099.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 104 1e-20 emb|CBI19404.3| unnamed protein product [Vitis vinifera] 104 1e-20 ref|XP_002285318.1| PREDICTED: U-box domain-containing protein 4... 104 1e-20 ref|XP_003550308.1| PREDICTED: U-box domain-containing protein 4... 103 2e-20 ref|XP_004252739.1| PREDICTED: U-box domain-containing protein 4... 103 3e-20 ref|XP_006342665.1| PREDICTED: U-box domain-containing protein 4... 102 5e-20 ref|XP_006356861.1| PREDICTED: U-box domain-containing protein 4... 102 7e-20 gb|EXB43805.1| U-box domain-containing protein 4 [Morus notabilis] 101 9e-20 ref|XP_004238092.1| PREDICTED: U-box domain-containing protein 4... 100 2e-19 ref|XP_007160909.1| hypothetical protein PHAVU_001G027300g [Phas... 100 3e-19 gb|EYU36380.1| hypothetical protein MIMGU_mgv1a009210mg [Mimulus... 99 5e-19 ref|XP_002301150.2| hypothetical protein POPTR_0002s11960g [Popu... 98 1e-18 ref|XP_007227457.1| hypothetical protein PRUPE_ppa007890mg [Prun... 98 1e-18 ref|XP_006607012.1| PREDICTED: U-box domain-containing protein 4... 97 2e-18 ref|XP_004498998.1| PREDICTED: U-box domain-containing protein 4... 96 4e-18 dbj|BAM15891.1| putative E3 ubiquitin ligase, partial [Pyrus pyr... 96 4e-18 >ref|XP_007018507.1| ARM repeat superfamily protein [Theobroma cacao] gi|508723835|gb|EOY15732.1| ARM repeat superfamily protein [Theobroma cacao] Length = 353 Score = 108 bits (269), Expect = 1e-21 Identities = 57/66 (86%), Positives = 59/66 (89%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 AAAILLQICEDSL YRTMVAREGAIPPLVALSQSGT RAKQKAE LI+LLRQPRS N AA Sbjct: 287 AAAILLQICEDSLVYRTMVAREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGNAAA 346 Query: 184 RMPDVS 201 R +VS Sbjct: 347 RPSNVS 352 >ref|XP_006472298.1| PREDICTED: U-box domain-containing protein 4-like [Citrus sinensis] Length = 350 Score = 106 bits (264), Expect = 4e-21 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQ+CE+S+ YRT+VAREGAIPPLVALSQSGT RAKQKAEALI+LLRQPRS N AA Sbjct: 284 AVAILLQVCEESVVYRTLVAREGAIPPLVALSQSGTNRAKQKAEALIELLRQPRSGNAAA 343 Query: 184 RMPDVS 201 R DVS Sbjct: 344 RASDVS 349 >ref|XP_006433633.1| hypothetical protein CICLE_v10001676mg [Citrus clementina] gi|557535755|gb|ESR46873.1| hypothetical protein CICLE_v10001676mg [Citrus clementina] Length = 350 Score = 106 bits (264), Expect = 4e-21 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQ+CE+S+ YRT+VAREGAIPPLVALSQSGT RAKQKAEALI+LLRQPRS N AA Sbjct: 284 AVAILLQVCEESVVYRTLVAREGAIPPLVALSQSGTNRAKQKAEALIELLRQPRSGNAAA 343 Query: 184 RMPDVS 201 R DVS Sbjct: 344 RASDVS 349 >ref|XP_004142891.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449482708|ref|XP_004156379.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Length = 352 Score = 104 bits (260), Expect = 1e-20 Identities = 55/66 (83%), Positives = 57/66 (86%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 AA ILLQICEDS+ YRTMVAREGAIPPLVALSQSGT RAKQKAE LI+LLRQPRS N AA Sbjct: 286 AAVILLQICEDSVLYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGNYAA 345 Query: 184 RMPDVS 201 DVS Sbjct: 346 TTSDVS 351 >ref|XP_002510099.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223550800|gb|EEF52286.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 352 Score = 104 bits (260), Expect = 1e-20 Identities = 54/66 (81%), Positives = 56/66 (84%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQICED+L R MV REGAIPPL+ALSQSGT RAKQKAE LIDLLRQPRS N AA Sbjct: 286 AVAILLQICEDNLMRRAMVVREGAIPPLIALSQSGTNRAKQKAETLIDLLRQPRSGNAAA 345 Query: 184 RMPDVS 201 R PDVS Sbjct: 346 RTPDVS 351 >emb|CBI19404.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 104 bits (259), Expect = 1e-20 Identities = 55/66 (83%), Positives = 56/66 (84%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQICEDSL YR MVAREGAIPPLVALSQS R+KQKAEALIDLLRQPRS N AA Sbjct: 322 AVAILLQICEDSLAYRNMVAREGAIPPLVALSQSSANRSKQKAEALIDLLRQPRSGNVAA 381 Query: 184 RMPDVS 201 R DVS Sbjct: 382 RTSDVS 387 >ref|XP_002285318.1| PREDICTED: U-box domain-containing protein 4 [Vitis vinifera] Length = 339 Score = 104 bits (259), Expect = 1e-20 Identities = 55/66 (83%), Positives = 56/66 (84%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQICEDSL YR MVAREGAIPPLVALSQS R+KQKAEALIDLLRQPRS N AA Sbjct: 273 AVAILLQICEDSLAYRNMVAREGAIPPLVALSQSSANRSKQKAEALIDLLRQPRSGNVAA 332 Query: 184 RMPDVS 201 R DVS Sbjct: 333 RTSDVS 338 >ref|XP_003550308.1| PREDICTED: U-box domain-containing protein 4 [Glycine max] Length = 352 Score = 103 bits (257), Expect = 2e-20 Identities = 52/61 (85%), Positives = 55/61 (90%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A ILLQ+CEDS+TYRTMVAREGAIPPLVALSQSGT RAKQKAE LI+LLRQPRS N AA Sbjct: 285 AVVILLQVCEDSVTYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGNGAA 344 Query: 184 R 186 R Sbjct: 345 R 345 >ref|XP_004252739.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 358 Score = 103 bits (256), Expect = 3e-20 Identities = 53/63 (84%), Positives = 56/63 (88%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 AAAILLQ+CEDS++YRTMVAREGAIPPLVALSQSGT RAKQKAE LI LLRQPRS N AA Sbjct: 288 AAAILLQLCEDSVSYRTMVAREGAIPPLVALSQSGTNRAKQKAETLIGLLRQPRSGNAAA 347 Query: 184 RMP 192 P Sbjct: 348 TTP 350 >ref|XP_006342665.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 358 Score = 102 bits (254), Expect = 5e-20 Identities = 53/63 (84%), Positives = 55/63 (87%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 AAAILLQ+CEDS+ YRTMVAREGAIPPLVALSQSGT RAKQKAE LI LLRQPRS N AA Sbjct: 288 AAAILLQLCEDSVCYRTMVAREGAIPPLVALSQSGTNRAKQKAETLIGLLRQPRSGNAAA 347 Query: 184 RMP 192 P Sbjct: 348 TTP 350 >ref|XP_006356861.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 356 Score = 102 bits (253), Expect = 7e-20 Identities = 52/60 (86%), Positives = 55/60 (91%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQICEDS+ YRTMVAREGAIPPLVALSQSGT+RAK+KAE LIDLLRQPRS N AA Sbjct: 286 AVAILLQICEDSVAYRTMVAREGAIPPLVALSQSGTSRAKRKAEKLIDLLRQPRSGNGAA 345 >gb|EXB43805.1| U-box domain-containing protein 4 [Morus notabilis] Length = 338 Score = 101 bits (252), Expect = 9e-20 Identities = 52/66 (78%), Positives = 58/66 (87%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQICE+S+ YRTMV+REGAIPPLVAL+QSGT RAKQKAE LI+LLRQPRS + AA Sbjct: 272 AVAILLQICEESVVYRTMVSREGAIPPLVALTQSGTNRAKQKAETLIELLRQPRSGSAAA 331 Query: 184 RMPDVS 201 R DVS Sbjct: 332 RPSDVS 337 >ref|XP_004238092.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 356 Score = 100 bits (250), Expect = 2e-19 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A +ILLQICEDS+ YRTMVAREGAIPPLVALSQSGT+RAK+KAE LIDLLRQPRS N AA Sbjct: 286 AVSILLQICEDSVAYRTMVAREGAIPPLVALSQSGTSRAKRKAEKLIDLLRQPRSGNGAA 345 >ref|XP_007160909.1| hypothetical protein PHAVU_001G027300g [Phaseolus vulgaris] gi|561034373|gb|ESW32903.1| hypothetical protein PHAVU_001G027300g [Phaseolus vulgaris] Length = 351 Score = 100 bits (248), Expect = 3e-19 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A ILLQ+CEDS+TYR+MVAREGAIPPLVALSQSGT RAKQKAE LI+LLRQPRS+N Sbjct: 285 AVVILLQVCEDSVTYRSMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSSNGGG 344 Query: 184 RMPDVS 201 R +++ Sbjct: 345 RASELA 350 >gb|EYU36380.1| hypothetical protein MIMGU_mgv1a009210mg [Mimulus guttatus] Length = 349 Score = 99.4 bits (246), Expect = 5e-19 Identities = 50/60 (83%), Positives = 55/60 (91%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A AILLQ+CED L YRTMVAREGAIPPLVAL+Q+GT+RAKQKAEALI+LLRQPRS N AA Sbjct: 289 AVAILLQLCEDCLAYRTMVAREGAIPPLVALTQTGTSRAKQKAEALIELLRQPRSGNAAA 348 >ref|XP_002301150.2| hypothetical protein POPTR_0002s11960g [Populus trichocarpa] gi|550344821|gb|EEE80423.2| hypothetical protein POPTR_0002s11960g [Populus trichocarpa] Length = 354 Score = 97.8 bits (242), Expect = 1e-18 Identities = 51/66 (77%), Positives = 57/66 (86%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 A +ILLQICED++ Y +MVAREGAIPPLVALSQSGT RAKQKAEALI+LLRQ RS N AA Sbjct: 288 AVSILLQICEDNMVYCSMVAREGAIPPLVALSQSGTNRAKQKAEALIELLRQLRSGNAAA 347 Query: 184 RMPDVS 201 + DVS Sbjct: 348 KTSDVS 353 >ref|XP_007227457.1| hypothetical protein PRUPE_ppa007890mg [Prunus persica] gi|462424393|gb|EMJ28656.1| hypothetical protein PRUPE_ppa007890mg [Prunus persica] Length = 352 Score = 97.8 bits (242), Expect = 1e-18 Identities = 51/66 (77%), Positives = 55/66 (83%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 + AILLQICE+S +R MVAREGAIPPLVALSQSGT RAKQKAE L +LLRQPRS N AA Sbjct: 286 SVAILLQICENSAVHRNMVAREGAIPPLVALSQSGTNRAKQKAETLTELLRQPRSGNVAA 345 Query: 184 RMPDVS 201 R DVS Sbjct: 346 RASDVS 351 >ref|XP_006607012.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 271 Score = 97.1 bits (240), Expect = 2e-18 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +1 Query: 13 ILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAARMP 192 ILLQ+CEDS+ YRTMVAREGAIPPLVALSQSGT RAKQKAE LI+LLRQPRS A R Sbjct: 208 ILLQVCEDSVAYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGYGAVRTS 267 Query: 193 DV 198 +V Sbjct: 268 EV 269 >ref|XP_004498998.1| PREDICTED: U-box domain-containing protein 4-like [Cicer arietinum] Length = 349 Score = 96.3 bits (238), Expect = 4e-18 Identities = 48/62 (77%), Positives = 54/62 (87%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 AA ILLQICEDS+ YRTMVAREGAIPPLVAL+QSGT RAKQKAE LI+LLRQPRS + + Sbjct: 285 AAVILLQICEDSVAYRTMVAREGAIPPLVALTQSGTNRAKQKAEKLIELLRQPRSTRSTS 344 Query: 184 RM 189 + Sbjct: 345 EI 346 >dbj|BAM15891.1| putative E3 ubiquitin ligase, partial [Pyrus pyrifolia var. culta] Length = 119 Score = 96.3 bits (238), Expect = 4e-18 Identities = 51/66 (77%), Positives = 54/66 (81%) Frame = +1 Query: 4 AAAILLQICEDSLTYRTMVAREGAIPPLVALSQSGTTRAKQKAEALIDLLRQPRSNNNAA 183 + AILLQICE S +R MVAREGAIPPLVALSQSGT RAKQKAE L +LLRQPRS N AA Sbjct: 53 SVAILLQICEHSEVHRNMVAREGAIPPLVALSQSGTNRAKQKAETLTELLRQPRSGNFAA 112 Query: 184 RMPDVS 201 R DVS Sbjct: 113 RASDVS 118