BLASTX nr result
ID: Akebia27_contig00009838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00009838 (565 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK232... 66 5e-09 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 64 3e-08 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 64 3e-08 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 63 6e-08 ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phas... 62 1e-07 gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus... 60 4e-07 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 60 5e-07 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 60 5e-07 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 59 1e-06 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 59 1e-06 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 58 1e-06 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 58 1e-06 ref|XP_004492183.1| PREDICTED: mitochondrial import receptor sub... 58 2e-06 ref|XP_001756540.1| predicted protein [Physcomitrella patens] gi... 57 3e-06 ref|NP_564545.1| translocase of the outer mitochondrial membrane... 57 4e-06 ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arab... 57 4e-06 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 56 6e-06 >gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK23244.1| unknown [Picea sitchensis] gi|116789568|gb|ABK25295.1| unknown [Picea sitchensis] Length = 55 Score = 66.2 bits (160), Expect = 5e-09 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MFLGAIPRRPDKA A KQLR H+T+ GIWVA +RV PY Sbjct: 1 MFLGAIPRRPDKAAAYKQLRKHLTLLGIWVAAIRVAPY 38 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 63.9 bits (154), Expect = 3e-08 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQLRTHV MFG WVAV+RVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPY 38 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 63.9 bits (154), Expect = 3e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQLR+HV MFG+WVAV+RVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPY 38 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 62.8 bits (151), Expect = 6e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL+ HV MFG+WVAVVRVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPY 38 >ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] gi|561004882|gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL++HVTMFG WV V+RVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPY 38 >gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus guttatus] Length = 122 Score = 60.1 bits (144), Expect = 4e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 494 REMFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 ++MF G R+PDKA ALKQLR+H MFG WVAV+RV PY Sbjct: 67 KKMFPGMFMRKPDKAAALKQLRSHAAMFGAWVAVIRVAPY 106 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G ++PDKA ALKQLR+HV MFG WV V+RVTPY Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPY 38 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 59.7 bits (143), Expect = 5e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL+THV +FG WVAV+RV PY Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPY 38 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL+TH +FG WVA++RVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPY 38 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G ++PDKA ALKQLR+HV MFG WV V+RVTPY Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPY 38 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL++HV MFG WV V+RVTPY Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPY 38 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL++H MFG WV V+RVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPY 38 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL++H MFG WV V+RVTPY Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPY 38 >ref|XP_004492183.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cicer arietinum] Length = 54 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQL++HV MFG WV V+RV PY Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGTWVVVIRVAPY 38 >ref|XP_001756540.1| predicted protein [Physcomitrella patens] gi|162692136|gb|EDQ78494.1| predicted protein [Physcomitrella patens] Length = 170 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = -3 Query: 500 REREMFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 +E MFLG IPRRPDKA A K L+ H+T G+W+ +R TPY Sbjct: 112 KEVVMFLGGIPRRPDKAEAHKTLKKHLTYLGLWICAIRATPY 153 >ref|NP_564545.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] gi|46577137|sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gi|5430759|gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gi|11692924|gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gi|11762280|gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gi|11935199|gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gi|12642920|gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gi|14335020|gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|27363338|gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|332194306|gb|AEE32427.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] Length = 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQLRTHV +FG WV ++R PY Sbjct: 1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPY 38 >ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] gi|297340022|gb|EFH70439.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = -3 Query: 488 MFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 MF G R+PDKA ALKQLRTHV +FG WV +VR PY Sbjct: 1 MFPGMFMRKPDKAVALKQLRTHVALFGGWVVIVRAVPY 38 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -3 Query: 491 EMFLGAIPRRPDKATALKQLRTHVTMFGIWVAVVRVTPY 375 +MF G R+PDKA ALKQL++H MFG W+AVVR PY Sbjct: 1 KMFPGMFMRKPDKAAALKQLKSHAIMFGAWIAVVRAAPY 39