BLASTX nr result
ID: Akebia27_contig00009233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00009233 (614 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006479897.1| PREDICTED: uncharacterized protein LOC102611... 59 1e-06 ref|XP_006444259.1| hypothetical protein CICLE_v10018467mg [Citr... 59 1e-06 ref|XP_007050826.1| CW-type Zinc Finger, putative isoform 1 [The... 58 2e-06 ref|XP_002269412.2| PREDICTED: uncharacterized protein LOC100254... 57 3e-06 emb|CBI32242.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CAN74679.1| hypothetical protein VITISV_006858 [Vitis vinifera] 57 3e-06 gb|EXB40814.1| hypothetical protein L484_009057 [Morus notabilis] 56 7e-06 >ref|XP_006479897.1| PREDICTED: uncharacterized protein LOC102611579 [Citrus sinensis] Length = 1710 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 612 EEAQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAI 502 EE QH E ISS++R LDFNF DV+GLLRLVRLAMEAI Sbjct: 1672 EEGQHKEGISSIKRALDFNFQDVEGLLRLVRLAMEAI 1708 >ref|XP_006444259.1| hypothetical protein CICLE_v10018467mg [Citrus clementina] gi|557546521|gb|ESR57499.1| hypothetical protein CICLE_v10018467mg [Citrus clementina] Length = 1695 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 612 EEAQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAI 502 EE QH E ISS++R LDFNF DV+GLLRLVRLAMEAI Sbjct: 1657 EEGQHKEGISSIKRALDFNFQDVEGLLRLVRLAMEAI 1693 >ref|XP_007050826.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|590718478|ref|XP_007050827.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|590718481|ref|XP_007050828.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|590718491|ref|XP_007050829.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|508703087|gb|EOX94983.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|508703088|gb|EOX94984.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|508703089|gb|EOX94985.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] gi|508703090|gb|EOX94986.1| CW-type Zinc Finger, putative isoform 1 [Theobroma cacao] Length = 1680 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 606 AQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAIGH 496 A+ GE+IS V++ LDFNF DV+GLLRLVRLAMEAI H Sbjct: 1644 AESGEVISFVKKALDFNFQDVEGLLRLVRLAMEAISH 1680 >ref|XP_002269412.2| PREDICTED: uncharacterized protein LOC100254466 [Vitis vinifera] Length = 1730 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 612 EEAQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAI 502 EE QH E ISS+++ LD+NF+DV+GLLRLVRLAMEAI Sbjct: 1692 EETQHKEGISSIKQALDYNFHDVEGLLRLVRLAMEAI 1728 >emb|CBI32242.3| unnamed protein product [Vitis vinifera] Length = 1398 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 612 EEAQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAI 502 EE QH E ISS+++ LD+NF+DV+GLLRLVRLAMEAI Sbjct: 1360 EETQHKEGISSIKQALDYNFHDVEGLLRLVRLAMEAI 1396 >emb|CAN74679.1| hypothetical protein VITISV_006858 [Vitis vinifera] Length = 1671 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 612 EEAQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAI 502 EE QH E ISS+++ LD+NF+DV+GLLRLVRLAMEAI Sbjct: 1633 EETQHKEGISSIKQALDYNFHDVEGLLRLVRLAMEAI 1669 >gb|EXB40814.1| hypothetical protein L484_009057 [Morus notabilis] Length = 1705 Score = 56.2 bits (134), Expect = 7e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 609 EAQHGEIISSVRRVLDFNFYDVQGLLRLVRLAMEAI 502 EA++GE ISS++R LDFNF DV GLLRLVRLAME I Sbjct: 1668 EAKYGESISSIKRALDFNFQDVDGLLRLVRLAMEVI 1703