BLASTX nr result
ID: Akebia27_contig00009178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00009178 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211960.1| hypothetical protein PRUPE_ppa006523mg [Prun... 72 1e-10 sp|Q9XF97.1|RL4_PRUAR RecName: Full=60S ribosomal protein L4; Al... 72 1e-10 ref|XP_006405018.1| hypothetical protein EUTSA_v10000184mg [Eutr... 70 2e-10 ref|NP_195907.1| 60S ribosomal protein L4-2 [Arabidopsis thalian... 70 3e-10 ref|XP_006398743.1| hypothetical protein EUTSA_v10013700mg [Eutr... 70 3e-10 ref|XP_006287869.1| hypothetical protein CARUB_v10001096mg [Caps... 70 3e-10 dbj|BAC42280.1| putative 60S ribosomal protein [Arabidopsis thal... 70 3e-10 ref|XP_002870995.1| 60S ribosomal protein L4/L1 [Arabidopsis lyr... 70 3e-10 emb|CBI32622.3| unnamed protein product [Vitis vinifera] 70 3e-10 emb|CBI16546.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|NP_001119159.1| 60S ribosomal protein L4-2 [Arabidopsis thal... 70 3e-10 ref|XP_002274975.1| PREDICTED: 60S ribosomal protein L4 [Vitis v... 70 3e-10 ref|XP_002285741.1| PREDICTED: 60S ribosomal protein L4-1 [Vitis... 70 3e-10 gb|AAK32901.1|AF367314_1 AT5g02870/F9G14_180 [Arabidopsis thalia... 70 3e-10 ref|XP_004137800.1| PREDICTED: 60S ribosomal protein L4-like [Cu... 70 4e-10 ref|XP_004512303.1| PREDICTED: 60S ribosomal protein L4-like [Ci... 69 5e-10 ref|XP_004497805.1| PREDICTED: 60S ribosomal protein L4-like [Ci... 69 5e-10 gb|EXB84816.1| 60S ribosomal protein L4 [Morus notabilis] 69 7e-10 ref|XP_006407657.1| hypothetical protein EUTSA_v10020851mg [Eutr... 69 7e-10 ref|XP_006297818.1| hypothetical protein CARUB_v10013852mg [Caps... 69 7e-10 >ref|XP_007211960.1| hypothetical protein PRUPE_ppa006523mg [Prunus persica] gi|462407825|gb|EMJ13159.1| hypothetical protein PRUPE_ppa006523mg [Prunus persica] Length = 408 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ Sbjct: 377 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 408 >sp|Q9XF97.1|RL4_PRUAR RecName: Full=60S ribosomal protein L4; AltName: Full=L1 gi|4887131|gb|AAD32206.1|AF134732_1 60S ribosomal protein L1 [Prunus armeniaca] Length = 408 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ Sbjct: 377 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 408 >ref|XP_006405018.1| hypothetical protein EUTSA_v10000184mg [Eutrema salsugineum] gi|557106146|gb|ESQ46471.1| hypothetical protein EUTSA_v10000184mg [Eutrema salsugineum] Length = 406 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLGV+Q Sbjct: 375 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVNQ 406 >ref|NP_195907.1| 60S ribosomal protein L4-2 [Arabidopsis thaliana] gi|20143905|sp|P49691.2|RL4B_ARATH RecName: Full=60S ribosomal protein L4-2; AltName: Full=L1 gi|7413562|emb|CAB86041.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|15450798|gb|AAK96670.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|16649033|gb|AAL24368.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|17064752|gb|AAL32530.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|20260072|gb|AAM13383.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|21387109|gb|AAM47958.1| 60S ribosomal protein-like protein [Arabidopsis thaliana] gi|22530964|gb|AAM96986.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|25083642|gb|AAN72099.1| 60S ribosomal protein-like [Arabidopsis thaliana] gi|332003146|gb|AED90529.1| 60S ribosomal protein L4-2 [Arabidopsis thaliana] Length = 407 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 376 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407 >ref|XP_006398743.1| hypothetical protein EUTSA_v10013700mg [Eutrema salsugineum] gi|557099833|gb|ESQ40196.1| hypothetical protein EUTSA_v10013700mg [Eutrema salsugineum] Length = 406 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 375 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_006287869.1| hypothetical protein CARUB_v10001096mg [Capsella rubella] gi|482556575|gb|EOA20767.1| hypothetical protein CARUB_v10001096mg [Capsella rubella] Length = 407 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 376 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407 >dbj|BAC42280.1| putative 60S ribosomal protein [Arabidopsis thaliana] Length = 407 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 376 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407 >ref|XP_002870995.1| 60S ribosomal protein L4/L1 [Arabidopsis lyrata subsp. lyrata] gi|297316832|gb|EFH47254.1| 60S ribosomal protein L4/L1 [Arabidopsis lyrata subsp. lyrata] Length = 407 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 376 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 407 >emb|CBI32622.3| unnamed protein product [Vitis vinifera] Length = 344 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNF+KWLGVSQ Sbjct: 313 IKAAGKAWYQTMISDSDYTEFDNFSKWLGVSQ 344 >emb|CBI16546.3| unnamed protein product [Vitis vinifera] Length = 63 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNF+KWLGVSQ Sbjct: 32 IKAAGKAWYQTMISDSDYTEFDNFSKWLGVSQ 63 >ref|NP_001119159.1| 60S ribosomal protein L4-2 [Arabidopsis thaliana] gi|332003147|gb|AED90530.1| 60S ribosomal protein L4-2 [Arabidopsis thaliana] Length = 406 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 375 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_002274975.1| PREDICTED: 60S ribosomal protein L4 [Vitis vinifera] Length = 406 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNF+KWLGVSQ Sbjct: 375 IKAAGKAWYQTMISDSDYTEFDNFSKWLGVSQ 406 >ref|XP_002285741.1| PREDICTED: 60S ribosomal protein L4-1 [Vitis vinifera] Length = 405 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNF+KWLGVSQ Sbjct: 374 IKAAGKAWYQTMISDSDYTEFDNFSKWLGVSQ 405 >gb|AAK32901.1|AF367314_1 AT5g02870/F9G14_180 [Arabidopsis thaliana] gi|22137186|gb|AAM91438.1| AT5g02870/F9G14_180 [Arabidopsis thaliana] gi|110740340|dbj|BAF02065.1| 60S ribosomal protein - like [Arabidopsis thaliana] Length = 307 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 276 IKAAGKAWYQTMISDSDYTEFDNFTKWLGASQ 307 >ref|XP_004137800.1| PREDICTED: 60S ribosomal protein L4-like [Cucumis sativus] gi|449519122|ref|XP_004166584.1| PREDICTED: 60S ribosomal protein L4-like [Cucumis sativus] Length = 405 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 +KAAGKAWYQTMISDSDYTEFDNF+KWLGVSQ Sbjct: 374 VKAAGKAWYQTMISDSDYTEFDNFSKWLGVSQ 405 >ref|XP_004512303.1| PREDICTED: 60S ribosomal protein L4-like [Cicer arietinum] Length = 406 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWY TM+SDSDYTEFDNFTKWLGVSQ Sbjct: 375 IKAAGKAWYNTMVSDSDYTEFDNFTKWLGVSQ 406 >ref|XP_004497805.1| PREDICTED: 60S ribosomal protein L4-like [Cicer arietinum] Length = 406 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGKAWY TM+SDSDYTEFDNFTKWLGVSQ Sbjct: 375 IKAAGKAWYNTMVSDSDYTEFDNFTKWLGVSQ 406 >gb|EXB84816.1| 60S ribosomal protein L4 [Morus notabilis] Length = 408 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGK+WYQTMISDSDYTEF+NFTKWLGVSQ Sbjct: 377 IKAAGKSWYQTMISDSDYTEFENFTKWLGVSQ 408 >ref|XP_006407657.1| hypothetical protein EUTSA_v10020851mg [Eutrema salsugineum] gi|557108803|gb|ESQ49110.1| hypothetical protein EUTSA_v10020851mg [Eutrema salsugineum] Length = 406 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGK+WYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 375 IKAAGKSWYQTMISDSDYTEFDNFTKWLGASQ 406 >ref|XP_006297818.1| hypothetical protein CARUB_v10013852mg [Capsella rubella] gi|482566527|gb|EOA30716.1| hypothetical protein CARUB_v10013852mg [Capsella rubella] Length = 406 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 384 IKAAGKAWYQTMISDSDYTEFDNFTKWLGVSQ 289 IKAAGK+WYQTMISDSDYTEFDNFTKWLG SQ Sbjct: 375 IKAAGKSWYQTMISDSDYTEFDNFTKWLGASQ 406