BLASTX nr result
ID: Akebia27_contig00009093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00009093 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOO01807.1| putative ubiquitin-conjugating enzyme protein [To... 181 7e-44 gb|EFQ33524.1| ubiquitin-conjugating enzyme [Colletotrichum gram... 181 7e-44 ref|XP_001906091.1| hypothetical protein [Podospora anserina S m... 181 7e-44 gb|EME49711.1| hypothetical protein DOTSEDRAFT_40871 [Dothistrom... 181 1e-43 ref|XP_007294326.1| ubiquitin-conjugating enzyme h [Marssonina b... 180 2e-43 gb|EGE77566.1| ubiquitin carrier protein [Ajellomyces dermatitid... 180 2e-43 gb|EQB51980.1| ubiquitin-conjugating enzyme [Colletotrichum gloe... 179 3e-43 gb|EPE25572.1| UBC-like protein [Glarea lozoyensis ATCC 20868] 179 3e-43 ref|XP_007276681.1| ubiquitin-conjugating enzyme [Colletotrichum... 179 3e-43 ref|XP_006694468.1| putative ubiquitin carrier protein [Chaetomi... 179 3e-43 gb|EGE03752.1| ubiquitin-conjugating enzyme h [Trichophyton equi... 179 4e-43 gb|EER41594.1| ubiquitin-conjugating enzyme E2 [Ajellomyces caps... 179 4e-43 ref|XP_389489.1| hypothetical protein FG09313.1 [Fusarium gramin... 179 5e-43 gb|EON68156.1| ubiquitin-conjugating enzyme E2 H [Coniosporium a... 179 5e-43 gb|EMR85631.1| putative ubiquitin-conjugating enzyme protein [Bo... 179 5e-43 gb|EKJ70177.1| hypothetical protein FPSE_09703 [Fusarium pseudog... 179 5e-43 gb|EHK99015.1| putative Ubiquitin-conjugating enzyme E2 8 [Glare... 179 5e-43 ref|XP_003235946.1| ubiquitin-conjugating enzyme E2 [Trichophyto... 179 5e-43 ref|XP_002847206.1| ubiquitin-conjugating enzyme h [Arthroderma ... 179 5e-43 ref|XP_002797359.1| ubiquitin-conjugating enzyme [Paracoccidioid... 179 5e-43 >gb|EOO01807.1| putative ubiquitin-conjugating enzyme protein [Togninia minima UCRPA7] Length = 189 Score = 181 bits (460), Expect = 7e-44 Identities = 83/86 (96%), Positives = 84/86 (97%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGP ETPFE GVWKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDV Sbjct: 33 RQEFYVRFKGPAETPFEGGVWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDV 92 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 93 INQTWSPMFDMINIFEVFLPQLLRYP 118 >gb|EFQ33524.1| ubiquitin-conjugating enzyme [Colletotrichum graminicola M1.001] Length = 176 Score = 181 bits (460), Expect = 7e-44 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -3 Query: 255 QEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVI 76 QEFYVRFKGPTETPFE GVWKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDVI Sbjct: 21 QEFYVRFKGPTETPFEGGVWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDVI 80 Query: 75 NQTWSPMFDMINIFEVFLPQLLRYP 1 NQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 81 NQTWSPMFDMINIFEVFLPQLLRYP 105 >ref|XP_001906091.1| hypothetical protein [Podospora anserina S mat+] gi|170941107|emb|CAP66757.1| unnamed protein product [Podospora anserina S mat+] Length = 187 Score = 181 bits (460), Expect = 7e-44 Identities = 83/85 (97%), Positives = 84/85 (98%) Frame = -3 Query: 255 QEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVI 76 QEFYVRFKGPTETPFE GVWKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDVI Sbjct: 30 QEFYVRFKGPTETPFEGGVWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDVI 89 Query: 75 NQTWSPMFDMINIFEVFLPQLLRYP 1 NQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 90 NQTWSPMFDMINIFEVFLPQLLRYP 114 >gb|EME49711.1| hypothetical protein DOTSEDRAFT_40871 [Dothistroma septosporum NZE10] Length = 187 Score = 181 bits (458), Expect = 1e-43 Identities = 81/86 (94%), Positives = 85/86 (98%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGPTETPFE G+WK+HVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDV Sbjct: 29 RQEFYVRFKGPTETPFEGGLWKIHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDV 88 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 89 INQTWSPMYDMINIFEVFLPQLLRYP 114 >ref|XP_007294326.1| ubiquitin-conjugating enzyme h [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862170|gb|EKD15221.1| ubiquitin-conjugating enzyme h [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 172 Score = 180 bits (456), Expect = 2e-43 Identities = 82/86 (95%), Positives = 84/86 (97%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGP ETPFE G+WKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDV Sbjct: 15 RQEFYVRFKGPKETPFEGGLWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDV 74 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 75 INQTWSPMFDMINIFEVFLPQLLRYP 100 >gb|EGE77566.1| ubiquitin carrier protein [Ajellomyces dermatitidis ATCC 18188] Length = 194 Score = 180 bits (456), Expect = 2e-43 Identities = 81/86 (94%), Positives = 84/86 (97%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGP ETPFE G+WK+HVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV Sbjct: 38 RQEFYVRFKGPEETPFEGGLWKIHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 97 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 98 INQTWSPMYDMINIFEVFLPQLLRYP 123 >gb|EQB51980.1| ubiquitin-conjugating enzyme [Colletotrichum gloeosporioides Cg-14] Length = 201 Score = 179 bits (455), Expect = 3e-43 Identities = 82/85 (96%), Positives = 83/85 (97%) Frame = -3 Query: 255 QEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVI 76 QEFYVRFKGP ETPFE GVWKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDVI Sbjct: 46 QEFYVRFKGPAETPFEGGVWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDVI 105 Query: 75 NQTWSPMFDMINIFEVFLPQLLRYP 1 NQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 106 NQTWSPMFDMINIFEVFLPQLLRYP 130 >gb|EPE25572.1| UBC-like protein [Glarea lozoyensis ATCC 20868] Length = 179 Score = 179 bits (455), Expect = 3e-43 Identities = 81/86 (94%), Positives = 84/86 (97%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGP ETPF+ G+WKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDV Sbjct: 23 RQEFYVRFKGPEETPFQGGIWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDV 82 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 83 INQTWSPMFDMINIFEVFLPQLLRYP 108 >ref|XP_007276681.1| ubiquitin-conjugating enzyme [Colletotrichum gloeosporioides Nara gc5] gi|429859499|gb|ELA34279.1| ubiquitin-conjugating enzyme [Colletotrichum gloeosporioides Nara gc5] Length = 180 Score = 179 bits (455), Expect = 3e-43 Identities = 82/85 (96%), Positives = 83/85 (97%) Frame = -3 Query: 255 QEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVI 76 QEFYVRFKGP ETPFE GVWKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDVI Sbjct: 25 QEFYVRFKGPAETPFEGGVWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDVI 84 Query: 75 NQTWSPMFDMINIFEVFLPQLLRYP 1 NQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 85 NQTWSPMFDMINIFEVFLPQLLRYP 109 >ref|XP_006694468.1| putative ubiquitin carrier protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340938961|gb|EGS19583.1| putative ubiquitin carrier protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 200 Score = 179 bits (455), Expect = 3e-43 Identities = 82/85 (96%), Positives = 83/85 (97%) Frame = -3 Query: 255 QEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVI 76 QEFYVRFKGP ETPFE GVWKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDVI Sbjct: 31 QEFYVRFKGPAETPFEGGVWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDVI 90 Query: 75 NQTWSPMFDMINIFEVFLPQLLRYP 1 NQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 91 NQTWSPMFDMINIFEVFLPQLLRYP 115 >gb|EGE03752.1| ubiquitin-conjugating enzyme h [Trichophyton equinum CBS 127.97] Length = 174 Score = 179 bits (454), Expect = 4e-43 Identities = 81/89 (91%), Positives = 84/89 (94%) Frame = -3 Query: 267 RSIRQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVC 88 + RQEFYVRFKGP ETPF G+WKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVC Sbjct: 15 KCFRQEFYVRFKGPEETPFAGGIWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVC 74 Query: 87 LDVINQTWSPMFDMINIFEVFLPQLLRYP 1 LDVINQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 75 LDVINQTWSPMYDMINIFEVFLPQLLRYP 103 >gb|EER41594.1| ubiquitin-conjugating enzyme E2 [Ajellomyces capsulatus H143] Length = 170 Score = 179 bits (454), Expect = 4e-43 Identities = 80/87 (91%), Positives = 85/87 (97%) Frame = -3 Query: 261 IRQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLD 82 ++QEFYVRFKGP ETPFE G+WK+HVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLD Sbjct: 13 MKQEFYVRFKGPEETPFEGGLWKIHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLD 72 Query: 81 VINQTWSPMFDMINIFEVFLPQLLRYP 1 VINQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 73 VINQTWSPMYDMINIFEVFLPQLLRYP 99 >ref|XP_389489.1| hypothetical protein FG09313.1 [Fusarium graminearum PH-1] gi|558865786|gb|ESU15869.1| hypothetical protein FGSG_09313 [Fusarium graminearum PH-1] gi|596548619|gb|EYB28342.1| hypothetical protein FG05_09313 [Fusarium graminearum] Length = 211 Score = 179 bits (453), Expect = 5e-43 Identities = 81/88 (92%), Positives = 84/88 (95%) Frame = -3 Query: 264 SIRQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCL 85 ++RQEFYVRFKGP ETPFE G WKVHVELPD YPYKSPSIGFVNRI+HPNIDELSGSVCL Sbjct: 53 TLRQEFYVRFKGPAETPFEGGTWKVHVELPDTYPYKSPSIGFVNRIFHPNIDELSGSVCL 112 Query: 84 DVINQTWSPMFDMINIFEVFLPQLLRYP 1 DVINQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 113 DVINQTWSPMFDMINIFEVFLPQLLRYP 140 >gb|EON68156.1| ubiquitin-conjugating enzyme E2 H [Coniosporium apollinis CBS 100218] Length = 214 Score = 179 bits (453), Expect = 5e-43 Identities = 81/94 (86%), Positives = 86/94 (91%) Frame = -3 Query: 282 MH*YLRSIRQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDEL 103 +H L RQEFYVRFKGP ETPF G+WK+HVELPDQYPYKSPSIGFVNRI+HPNIDEL Sbjct: 49 LHQQLTYFRQEFYVRFKGPEETPFSGGLWKIHVELPDQYPYKSPSIGFVNRIFHPNIDEL 108 Query: 102 SGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYP 1 SGSVCLDVINQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 109 SGSVCLDVINQTWSPMYDMINIFEVFLPQLLRYP 142 >gb|EMR85631.1| putative ubiquitin-conjugating enzyme protein [Botryotinia fuckeliana BcDW1] Length = 208 Score = 179 bits (453), Expect = 5e-43 Identities = 80/86 (93%), Positives = 84/86 (97%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 +QEFYVRFKGP ETPFE G+WK+HVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLDV Sbjct: 50 KQEFYVRFKGPAETPFEGGLWKIHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLDV 109 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 110 INQTWSPMFDMINIFEVFLPQLLRYP 135 >gb|EKJ70177.1| hypothetical protein FPSE_09703 [Fusarium pseudograminearum CS3096] Length = 219 Score = 179 bits (453), Expect = 5e-43 Identities = 81/88 (92%), Positives = 84/88 (95%) Frame = -3 Query: 264 SIRQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCL 85 ++RQEFYVRFKGP ETPFE G WKVHVELPD YPYKSPSIGFVNRI+HPNIDELSGSVCL Sbjct: 61 TLRQEFYVRFKGPAETPFEGGTWKVHVELPDTYPYKSPSIGFVNRIFHPNIDELSGSVCL 120 Query: 84 DVINQTWSPMFDMINIFEVFLPQLLRYP 1 DVINQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 121 DVINQTWSPMFDMINIFEVFLPQLLRYP 148 >gb|EHK99015.1| putative Ubiquitin-conjugating enzyme E2 8 [Glarea lozoyensis 74030] Length = 158 Score = 179 bits (453), Expect = 5e-43 Identities = 80/87 (91%), Positives = 85/87 (97%) Frame = -3 Query: 261 IRQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLD 82 ++QEFYVRFKGP ETPF+ G+WKVHVELPDQYPYKSPSIGFVNRI+HPNIDELSGSVCLD Sbjct: 1 MKQEFYVRFKGPEETPFQGGIWKVHVELPDQYPYKSPSIGFVNRIFHPNIDELSGSVCLD 60 Query: 81 VINQTWSPMFDMINIFEVFLPQLLRYP 1 VINQTWSPMFDMINIFEVFLPQLLRYP Sbjct: 61 VINQTWSPMFDMINIFEVFLPQLLRYP 87 >ref|XP_003235946.1| ubiquitin-conjugating enzyme E2 [Trichophyton rubrum CBS 118892] gi|326461288|gb|EGD86741.1| ubiquitin-conjugating enzyme E2 [Trichophyton rubrum CBS 118892] gi|607875023|gb|EZF20213.1| hypothetical protein H100_05270 [Trichophyton rubrum MR850] gi|607903282|gb|EZF40777.1| hypothetical protein H102_05260 [Trichophyton rubrum CBS 100081] gi|607915360|gb|EZF51394.1| hypothetical protein H103_05261 [Trichophyton rubrum CBS 288.86] gi|607927482|gb|EZF62075.1| hypothetical protein H104_05251 [Trichophyton rubrum CBS 289.86] gi|607939382|gb|EZF72668.1| hypothetical protein H105_05279 [Trichophyton soudanense CBS 452.61] gi|607951520|gb|EZF83448.1| hypothetical protein H110_05258 [Trichophyton rubrum MR1448] gi|607963640|gb|EZF94105.1| hypothetical protein H113_05299 [Trichophyton rubrum MR1459] gi|607976169|gb|EZG05380.1| hypothetical protein H106_05101 [Trichophyton rubrum CBS 735.88] gi|607987650|gb|EZG15677.1| hypothetical protein H107_05390 [Trichophyton rubrum CBS 202.88] Length = 184 Score = 179 bits (453), Expect = 5e-43 Identities = 81/86 (94%), Positives = 83/86 (96%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGP ETPF G+WKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV Sbjct: 28 RQEFYVRFKGPEETPFAGGIWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 87 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 88 INQTWSPMYDMINIFEVFLPQLLRYP 113 >ref|XP_002847206.1| ubiquitin-conjugating enzyme h [Arthroderma otae CBS 113480] gi|238842462|gb|EEQ32124.1| ubiquitin-conjugating enzyme h [Arthroderma otae CBS 113480] Length = 194 Score = 179 bits (453), Expect = 5e-43 Identities = 81/86 (94%), Positives = 83/86 (96%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 RQEFYVRFKGP ETPF G+WKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV Sbjct: 38 RQEFYVRFKGPEETPFAGGIWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 97 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 98 INQTWSPMYDMINIFEVFLPQLLRYP 123 >ref|XP_002797359.1| ubiquitin-conjugating enzyme [Paracoccidioides sp. 'lutzii' Pb01] gi|226282731|gb|EEH38297.1| ubiquitin-conjugating enzyme [Paracoccidioides sp. 'lutzii' Pb01] Length = 185 Score = 179 bits (453), Expect = 5e-43 Identities = 80/86 (93%), Positives = 84/86 (97%) Frame = -3 Query: 258 RQEFYVRFKGPTETPFENGVWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 79 +QEFYVRFKGP ETPFE G+WK+HVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV Sbjct: 29 KQEFYVRFKGPEETPFEGGLWKIHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDV 88 Query: 78 INQTWSPMFDMINIFEVFLPQLLRYP 1 INQTWSPM+DMINIFEVFLPQLLRYP Sbjct: 89 INQTWSPMYDMINIFEVFLPQLLRYP 114