BLASTX nr result
ID: Akebia27_contig00007211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00007211 (446 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521160.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_002521160.1| conserved hypothetical protein [Ricinus communis] gi|223539729|gb|EEF41311.1| conserved hypothetical protein [Ricinus communis] Length = 520 Score = 56.2 bits (134), Expect = 5e-06 Identities = 37/103 (35%), Positives = 54/103 (52%), Gaps = 1/103 (0%) Frame = +2 Query: 2 ITDFFGEPHSSTHPSFHLLWNDIKHVSSSLLTGDETESCLALDSSSHTRIPTQFAKDAFD 181 ++DF+ +S T + N+ +SS LT D E L D S F++D + Sbjct: 421 VSDFWRNHYSHTCHALEFPQNE--GMSSYFLTWDNNEKYL--DGLSRRENINHFSEDKVN 476 Query: 182 IHDFSSFGFKISRNDEMACPLLLDESSW-DGSKEISWDSNEDK 307 +HD SS F++S + E ACPLLL +S W D E+ +D NE K Sbjct: 477 VHDLSSIYFQMSVDKEKACPLLLGKSQWYDSKAEMYFDDNEVK 519