BLASTX nr result
ID: Akebia27_contig00007158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00007158 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40915.1| hypothetical protein MIMGU_mgv1a015580mg [Mimulus... 69 7e-10 gb|EYU40914.1| hypothetical protein MIMGU_mgv1a015580mg [Mimulus... 69 7e-10 gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] 69 7e-10 gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] 69 7e-10 ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana... 69 7e-10 ref|XP_006658321.1| PREDICTED: 40S ribosomal protein S18-like [O... 69 7e-10 ref|XP_006650718.1| PREDICTED: 40S ribosomal protein S18-like [O... 69 7e-10 ref|XP_006350987.1| PREDICTED: 40S ribosomal protein S18-like [S... 69 7e-10 ref|XP_007143544.1| hypothetical protein PHAVU_007G080500g [Phas... 69 7e-10 ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citr... 69 7e-10 ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citr... 69 7e-10 ref|XP_006415047.1| hypothetical protein EUTSA_v10009003mg [Eutr... 69 7e-10 gb|EPS72546.1| hypothetical protein M569_02206 [Genlisea aurea] 69 7e-10 gb|EPS57469.1| hypothetical protein M569_17345, partial [Genlise... 69 7e-10 ref|XP_004967782.1| PREDICTED: 40S ribosomal protein S18-like [S... 69 7e-10 ref|XP_004955596.1| PREDICTED: 40S ribosomal protein S18-like [S... 69 7e-10 ref|XP_007019598.1| S18 ribosomal protein [Theobroma cacao] gi|5... 69 7e-10 ref|XP_004496437.1| PREDICTED: 40S ribosomal protein S18-like [C... 69 7e-10 ref|XP_004489927.1| PREDICTED: 40S ribosomal protein S18-like [C... 69 7e-10 ref|XP_006305745.1| hypothetical protein CARUB_v10010553mg [Caps... 69 7e-10 >gb|EYU40915.1| hypothetical protein MIMGU_mgv1a015580mg [Mimulus guttatus] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >gb|EYU40914.1| hypothetical protein MIMGU_mgv1a015580mg [Mimulus guttatus] Length = 126 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 81 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 126 >gb|EXB41289.1| 40S ribosomal protein S18 [Morus notabilis] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >gb|EXB39391.1| 40S ribosomal protein S18 [Morus notabilis] Length = 225 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 180 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 225 >ref|NP_173692.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|15234790|ref|NP_192718.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|18399100|ref|NP_564434.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|297809155|ref|XP_002872461.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297845304|ref|XP_002890533.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297851838|ref|XP_002893800.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|464707|sp|P34788.1|RS18_ARATH RecName: Full=40S ribosomal protein S18 gi|10086474|gb|AAG12534.1|AC015446_15 ribosomal protein S18 [Arabidopsis thaliana] gi|10092450|gb|AAG12853.1|AC079286_10 40S ribosomal protein S18; 25853-24673 [Arabidopsis thaliana] gi|14423408|gb|AAK62386.1|AF386941_1 S18.A ribosomal protein [Arabidopsis thaliana] gi|15724158|gb|AAL06471.1|AF411781_1 At1g22780/T22J18_5 [Arabidopsis thaliana] gi|405613|emb|CAA80684.1| ribosomal protein S18A [Arabidopsis thaliana] gi|434343|emb|CAA82273.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434345|emb|CAA82274.1| S18 ribosomal protein [Arabidopsis thaliana] gi|434906|emb|CAA82275.1| S18 ribosomal protein [Arabidopsis thaliana] gi|2505871|emb|CAA72909.1| ribosomal protein S18A [Arabidopsis thaliana] gi|3287678|gb|AAC25506.1| Match to ribosomal S18 gene mRNA gb|Z28701, DNA gb|Z23165 from A. thaliana. ESTs gb|T21121, gb|Z17755, gb|R64776 and gb|R30430 come from this gene [Arabidopsis thaliana] gi|4538910|emb|CAB39647.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|7267675|emb|CAB78103.1| S18.A ribosomal protein [Arabidopsis thaliana] gi|14334584|gb|AAK59471.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|17979113|gb|AAL47500.1| putative ribosomal protein S18 [Arabidopsis thaliana] gi|21555397|gb|AAM63849.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21592452|gb|AAM64403.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|21593027|gb|AAM64976.1| ribosomal protein S18, putative [Arabidopsis thaliana] gi|30102858|gb|AAP21347.1| At4g09800 [Arabidopsis thaliana] gi|56236126|gb|AAV84519.1| At1g22780 [Arabidopsis thaliana] gi|98961089|gb|ABF59028.1| At1g22780 [Arabidopsis thaliana] gi|145713244|gb|ABP96570.1| pointed first leaf [Arabidopsis thaliana] gi|145713246|gb|ABP96571.1| pointed first leaf [Arabidopsis thaliana] gi|145713248|gb|ABP96572.1| pointed first leaf [Arabidopsis thaliana] gi|145713250|gb|ABP96573.1| pointed first leaf [Arabidopsis thaliana] gi|145713252|gb|ABP96574.1| pointed first leaf [Arabidopsis thaliana] gi|145713254|gb|ABP96575.1| pointed first leaf [Arabidopsis thaliana] gi|145713256|gb|ABP96576.1| pointed first leaf [Arabidopsis thaliana] gi|145713258|gb|ABP96577.1| pointed first leaf [Arabidopsis thaliana] gi|145713260|gb|ABP96578.1| pointed first leaf [Arabidopsis thaliana] gi|145713262|gb|ABP96579.1| pointed first leaf [Arabidopsis thaliana] gi|145713264|gb|ABP96580.1| pointed first leaf [Arabidopsis thaliana] gi|145713266|gb|ABP96581.1| pointed first leaf [Arabidopsis thaliana] gi|145713268|gb|ABP96582.1| pointed first leaf [Arabidopsis thaliana] gi|145713270|gb|ABP96583.1| pointed first leaf [Arabidopsis thaliana] gi|145713272|gb|ABP96584.1| pointed first leaf [Arabidopsis thaliana] gi|145713274|gb|ABP96585.1| pointed first leaf [Arabidopsis thaliana] gi|145713276|gb|ABP96586.1| pointed first leaf [Arabidopsis thaliana] gi|145713278|gb|ABP96587.1| pointed first leaf [Arabidopsis thaliana] gi|145713280|gb|ABP96588.1| pointed first leaf [Arabidopsis thaliana] gi|145713282|gb|ABP96589.1| pointed first leaf [Arabidopsis thaliana] gi|145713284|gb|ABP96590.1| pointed first leaf [Arabidopsis thaliana] gi|297318298|gb|EFH48720.1| hypothetical protein ARALYDRAFT_489832 [Arabidopsis lyrata subsp. lyrata] gi|297336375|gb|EFH66792.1| hypothetical protein ARALYDRAFT_472522 [Arabidopsis lyrata subsp. lyrata] gi|297339642|gb|EFH70059.1| hypothetical protein ARALYDRAFT_473557 [Arabidopsis lyrata subsp. lyrata] gi|332192166|gb|AEE30287.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332193538|gb|AEE31659.1| 40S ribosomal protein S18 [Arabidopsis thaliana] gi|332657400|gb|AEE82800.1| 40S ribosomal protein S18 [Arabidopsis thaliana] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_006658321.1| PREDICTED: 40S ribosomal protein S18-like [Oryza brachyantha] Length = 161 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 116 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 161 >ref|XP_006650718.1| PREDICTED: 40S ribosomal protein S18-like [Oryza brachyantha] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_006350987.1| PREDICTED: 40S ribosomal protein S18-like [Solanum tuberosum] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_007143544.1| hypothetical protein PHAVU_007G080500g [Phaseolus vulgaris] gi|593685795|ref|XP_007143576.1| hypothetical protein PHAVU_007G083400g [Phaseolus vulgaris] gi|561016734|gb|ESW15538.1| hypothetical protein PHAVU_007G080500g [Phaseolus vulgaris] gi|561016766|gb|ESW15570.1| hypothetical protein PHAVU_007G083400g [Phaseolus vulgaris] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_006434520.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] gi|568838213|ref|XP_006473109.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557536642|gb|ESR47760.1| hypothetical protein CICLE_v10002764mg [Citrus clementina] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_006419931.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] gi|568872460|ref|XP_006489386.1| PREDICTED: 40S ribosomal protein S18-like [Citrus sinensis] gi|557521804|gb|ESR33171.1| hypothetical protein CICLE_v10006140mg [Citrus clementina] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_006415047.1| hypothetical protein EUTSA_v10009003mg [Eutrema salsugineum] gi|567163760|ref|XP_006397143.1| hypothetical protein EUTSA_v10029039mg [Eutrema salsugineum] gi|557092818|gb|ESQ33400.1| hypothetical protein EUTSA_v10009003mg [Eutrema salsugineum] gi|557098160|gb|ESQ38596.1| hypothetical protein EUTSA_v10029039mg [Eutrema salsugineum] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >gb|EPS72546.1| hypothetical protein M569_02206 [Genlisea aurea] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >gb|EPS57469.1| hypothetical protein M569_17345, partial [Genlisea aurea] Length = 151 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 106 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 151 >ref|XP_004967782.1| PREDICTED: 40S ribosomal protein S18-like [Setaria italica] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_004955596.1| PREDICTED: 40S ribosomal protein S18-like [Setaria italica] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_007019598.1| S18 ribosomal protein [Theobroma cacao] gi|590601179|ref|XP_007019599.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|590601183|ref|XP_007019600.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|508724926|gb|EOY16823.1| S18 ribosomal protein [Theobroma cacao] gi|508724927|gb|EOY16824.1| S18 ribosomal protein isoform 1 [Theobroma cacao] gi|508724928|gb|EOY16825.1| S18 ribosomal protein isoform 1 [Theobroma cacao] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_004496437.1| PREDICTED: 40S ribosomal protein S18-like [Cicer arietinum] gi|502118979|ref|XP_004496465.1| PREDICTED: 40S ribosomal protein S18-like [Cicer arietinum] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_004489927.1| PREDICTED: 40S ribosomal protein S18-like [Cicer arietinum] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152 >ref|XP_006305745.1| hypothetical protein CARUB_v10010553mg [Capsella rubella] gi|482574456|gb|EOA38643.1| hypothetical protein CARUB_v10010553mg [Capsella rubella] Length = 152 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +1 Query: 1 LRDDLERLKKIRNHRGLRHYWGLRVRGQHXXXXXXXXXXXXXSKKR 138 LRDDLERLKKIRNHRGLRHYWGLRVRGQH SKKR Sbjct: 107 LRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR 152