BLASTX nr result
ID: Akebia27_contig00006772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00006772 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490712.1| PREDICTED: uncharacterized protein LOC101490... 62 1e-07 >ref|XP_004490712.1| PREDICTED: uncharacterized protein LOC101490873 [Cicer arietinum] Length = 811 Score = 61.6 bits (148), Expect = 1e-07 Identities = 41/102 (40%), Positives = 49/102 (48%), Gaps = 8/102 (7%) Frame = -3 Query: 381 PSPARGRNPTPVTHGLLPRSPHNNGQAATLSEIKSPEKASQEPSLEGFPALPVCSKPTPL 202 P P RGR P THG L R P NNG A E+ P + S EP+LEG+PAL + Sbjct: 656 PMPGRGRGQAPGTHGHLQRYPRNNGLALAPQELNLPVEGSFEPALEGYPALGNGKARSSE 715 Query: 201 RLFPQ--------ANENSLTTEKFESGSFGCPSVSTPPLPEV 100 F Q AN ++K ESGS P + PP EV Sbjct: 716 TYFSQPSTWSSRHANGFPHLSDKHESGSVS-PQLRGPPRTEV 756