BLASTX nr result
ID: Akebia27_contig00006214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00006214 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445146.1| hypothetical protein CICLE_v10020177mg [Citr... 59 5e-07 ref|XP_002511799.1| cop9 signalosome complex subunit, putative [... 59 7e-07 emb|CAY85529.1| Cop11 protein [Carica papaya] 58 1e-06 ref|XP_002272895.1| PREDICTED: COP9 signalosome complex subunit ... 58 1e-06 emb|CAN74681.1| hypothetical protein VITISV_025856 [Vitis vinifera] 58 1e-06 ref|XP_007134963.1| hypothetical protein PHAVU_010G090500g [Phas... 56 5e-06 ref|XP_007051916.1| COP9 signalosome complex subunit 1 [Theobrom... 56 5e-06 ref|XP_006291146.1| hypothetical protein CARUB_v10017264mg [Caps... 56 5e-06 gb|EXB44735.1| COP9 signalosome complex subunit 1 [Morus notabilis] 56 6e-06 >ref|XP_006445146.1| hypothetical protein CICLE_v10020177mg [Citrus clementina] gi|568875880|ref|XP_006491018.1| PREDICTED: COP9 signalosome complex subunit 1-like [Citrus sinensis] gi|557547408|gb|ESR58386.1| hypothetical protein CICLE_v10020177mg [Citrus clementina] Length = 441 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARRL 96 QTGSEFD+DVR+MLLRANLLKHEYN+R AR+L Sbjct: 410 QTGSEFDQDVRAMLLRANLLKHEYNVRAARKL 441 >ref|XP_002511799.1| cop9 signalosome complex subunit, putative [Ricinus communis] gi|223548979|gb|EEF50468.1| cop9 signalosome complex subunit, putative [Ricinus communis] Length = 433 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARRL 96 QTG+EFDRDVR+MLLRANL+KHEYNLR +R+L Sbjct: 402 QTGNEFDRDVRAMLLRANLIKHEYNLRASRKL 433 >emb|CAY85529.1| Cop11 protein [Carica papaya] Length = 440 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARR 93 QTG+EFDRDVR+MLLRANLLKHEYNLR +R+ Sbjct: 409 QTGNEFDRDVRAMLLRANLLKHEYNLRASRK 439 >ref|XP_002272895.1| PREDICTED: COP9 signalosome complex subunit 1 [Vitis vinifera] gi|296089065|emb|CBI38768.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARR 93 QTG+EFDRDVR+MLLRANLLKHEYNLR +R+ Sbjct: 410 QTGNEFDRDVRAMLLRANLLKHEYNLRASRK 440 >emb|CAN74681.1| hypothetical protein VITISV_025856 [Vitis vinifera] Length = 451 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARR 93 QTG+EFDRDVR+MLLRANLLKHEYNLR +R+ Sbjct: 420 QTGNEFDRDVRAMLLRANLLKHEYNLRASRK 450 >ref|XP_007134963.1| hypothetical protein PHAVU_010G090500g [Phaseolus vulgaris] gi|561008008|gb|ESW06957.1| hypothetical protein PHAVU_010G090500g [Phaseolus vulgaris] Length = 444 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARRL 96 +TG EFDRDVRSMLLR+NL+KHEYNLR R+L Sbjct: 413 ETGREFDRDVRSMLLRSNLIKHEYNLRALRKL 444 >ref|XP_007051916.1| COP9 signalosome complex subunit 1 [Theobroma cacao] gi|508704177|gb|EOX96073.1| COP9 signalosome complex subunit 1 [Theobroma cacao] Length = 541 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARRL 96 QTG+EFD+DVR+MLLRANLLKH+YN+R +R+L Sbjct: 510 QTGNEFDKDVRAMLLRANLLKHDYNVRASRKL 541 >ref|XP_006291146.1| hypothetical protein CARUB_v10017264mg [Capsella rubella] gi|565466534|ref|XP_006291147.1| hypothetical protein CARUB_v10017264mg [Capsella rubella] gi|482559853|gb|EOA24044.1| hypothetical protein CARUB_v10017264mg [Capsella rubella] gi|482559854|gb|EOA24045.1| hypothetical protein CARUB_v10017264mg [Capsella rubella] Length = 441 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARRL 96 Q G EFDRDVRSMLLRANLLKHEY+ RT+R+L Sbjct: 410 QMGDEFDRDVRSMLLRANLLKHEYHARTSRKL 441 >gb|EXB44735.1| COP9 signalosome complex subunit 1 [Morus notabilis] Length = 457 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 1 QTGSEFDRDVRSMLLRANLLKHEYNLRTARR 93 QTGSEFDRDVRSMLLRANL+K+E+NLR +R+ Sbjct: 426 QTGSEFDRDVRSMLLRANLIKYEFNLRASRK 456