BLASTX nr result
ID: Akebia27_contig00005097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00005097 (658 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB52708.1| hypothetical protein L484_022485 [Morus notabilis] 60 6e-07 ref|XP_003528820.1| PREDICTED: protein ABIL1-like [Glycine max] 60 8e-07 ref|XP_002511938.1| Protein ABIL1, putative [Ricinus communis] g... 59 2e-06 ref|XP_007135156.1| hypothetical protein PHAVU_010G105800g [Phas... 56 9e-06 >gb|EXB52708.1| hypothetical protein L484_022485 [Morus notabilis] Length = 299 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 608 TTQDSLEASKPLTTFKSFDNGVRREIVHAPIRSKSMLSAFF 486 T +D +E SKPLT F+SFDN RREIV P+RSKS+LSAFF Sbjct: 240 TRKDGMEGSKPLTAFRSFDNQNRREIVRVPVRSKSVLSAFF 280 >ref|XP_003528820.1| PREDICTED: protein ABIL1-like [Glycine max] Length = 311 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -3 Query: 608 TTQDSLEASKPLTTFKSFDNGVRREIVHAPIRSKSMLSAFF 486 T +D+LE SKP TTF+SFDN RRE V P RSKSMLSAFF Sbjct: 257 TRKDALEGSKPFTTFRSFDNQNRRETVQVPTRSKSMLSAFF 297 >ref|XP_002511938.1| Protein ABIL1, putative [Ricinus communis] gi|223549118|gb|EEF50607.1| Protein ABIL1, putative [Ricinus communis] Length = 307 Score = 58.5 bits (140), Expect = 2e-06 Identities = 34/57 (59%), Positives = 39/57 (68%) Frame = -3 Query: 656 QTFGFTRRAISKSTTKTTQDSLEASKPLTTFKSFDNGVRREIVHAPIRSKSMLSAFF 486 QTFG RR ++L++SKPLT F+SFDN RREIV AP RSKSMLSAFF Sbjct: 248 QTFGVARR-----------EALDSSKPLTAFRSFDNP-RREIVRAPARSKSMLSAFF 292 >ref|XP_007135156.1| hypothetical protein PHAVU_010G105800g [Phaseolus vulgaris] gi|561008201|gb|ESW07150.1| hypothetical protein PHAVU_010G105800g [Phaseolus vulgaris] Length = 309 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -3 Query: 608 TTQDSLEASKPLTTFKSFDNGVRREIVHAPIRSKSMLSAFF 486 T +DSLE SK LT F+SFDN RRE V P RSKS+LSAFF Sbjct: 255 TRKDSLEGSKQLTAFRSFDNPKRREAVQVPTRSKSVLSAFF 295