BLASTX nr result
ID: Akebia27_contig00005073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00005073 (685 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] 73 1e-10 ref|NP_569676.1| hypothetical protein PsnuCp071 [Psilotum nudum]... 60 5e-07 ref|XP_006837985.1| hypothetical protein AMTR_s00102p00104400 [A... 56 1e-05 >gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] Length = 173 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 416 KKSFPLGQVVGEEAFEPPTPWFMATCSNPLSYRSHPISTGS 538 ++ FP G VVGEE FEPPTPWF+AT SNPLSYR HP+STGS Sbjct: 5 ERYFPFGPVVGEEGFEPPTPWFVATRSNPLSYRPHPVSTGS 45 >ref|NP_569676.1| hypothetical protein PsnuCp071 [Psilotum nudum] gi|18860386|ref|NP_569702.1| hypothetical protein PsnuCp097 [Psilotum nudum] gi|18389513|dbj|BAB84265.1| hypothetical protein [Psilotum nudum] gi|18389539|dbj|BAB84291.1| hypothetical protein [Psilotum nudum] Length = 89 Score = 60.5 bits (145), Expect = 5e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +2 Query: 419 KSFPLGQVVGEEAFEPPTPWFMATCSNPLSYRSH 520 ++F LG ++GEE FEPPTPWF+ATCS+PLSY+ H Sbjct: 19 RTFALGLIMGEEGFEPPTPWFVATCSDPLSYKPH 52 >ref|XP_006837985.1| hypothetical protein AMTR_s00102p00104400 [Amborella trichopoda] gi|548840400|gb|ERN00554.1| hypothetical protein AMTR_s00102p00104400 [Amborella trichopoda] Length = 81 Score = 56.2 bits (134), Expect = 1e-05 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 440 VVGEEAFEPPTPWFMATCSNPLSYRSHP 523 VVG+E FEPPT WF+ATCSNPLSYR HP Sbjct: 44 VVGKEGFEPPTLWFVATCSNPLSYRPHP 71