BLASTX nr result
ID: Akebia27_contig00004806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00004806 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007137345.1| hypothetical protein PHAVU_009G119300g [Phas... 72 8e-11 ref|XP_002278879.1| PREDICTED: uncharacterized protein LOC100260... 70 4e-10 ref|XP_006422591.1| hypothetical protein CICLE_v10029481mg [Citr... 69 5e-10 ref|XP_002534419.1| metal ion binding protein, putative [Ricinus... 69 5e-10 ref|XP_006466995.1| PREDICTED: heavy metal-associated isoprenyla... 68 1e-09 gb|EXC16575.1| hypothetical protein L484_008381 [Morus notabilis] 67 2e-09 ref|XP_004134849.1| PREDICTED: heavy metal-associated isoprenyla... 67 3e-09 ref|XP_002306185.1| GMFP7 family protein [Populus trichocarpa] g... 66 4e-09 ref|XP_006577898.1| PREDICTED: heavy metal-associated isoprenyla... 66 6e-09 ref|XP_003612216.1| Atfp6-like protein [Medicago truncatula] gi|... 65 7e-09 ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma ... 65 1e-08 ref|XP_002272585.1| PREDICTED: uncharacterized protein LOC100261... 63 4e-08 ref|XP_002272623.1| PREDICTED: uncharacterized protein LOC100256... 63 4e-08 ref|XP_006282751.1| hypothetical protein CARUB_v10005941mg [Caps... 63 5e-08 ref|XP_006411650.1| hypothetical protein EUTSA_v10026471mg [Eutr... 62 6e-08 ref|NP_195570.1| farnesylated protein 6 [Arabidopsis thaliana] g... 62 6e-08 gb|AAM60879.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] 62 6e-08 ref|XP_007201826.1| hypothetical protein PRUPE_ppa012801mg [Prun... 62 8e-08 gb|AFK45838.1| unknown [Lotus japonicus] 62 8e-08 gb|ABK95274.1| unknown [Populus trichocarpa] 62 8e-08 >ref|XP_007137345.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris] gi|543176614|gb|AGV54330.1| metal ion binding protein [Phaseolus vulgaris] gi|561010432|gb|ESW09339.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris] Length = 154 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/56 (60%), Positives = 45/56 (80%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 MG+L ++ S L + SHGS KL K Q+ TVE++VKMDC+GC RKV++AVEGMKG+N Sbjct: 1 MGAL-DHISELFDCSHGSSKLKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVN 55 >ref|XP_002278879.1| PREDICTED: uncharacterized protein LOC100260571 isoform 1 [Vitis vinifera] gi|359475023|ref|XP_003631570.1| PREDICTED: uncharacterized protein LOC100260571 isoform 2 [Vitis vinifera] gi|147802513|emb|CAN62146.1| hypothetical protein VITISV_016892 [Vitis vinifera] gi|297744607|emb|CBI37869.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/55 (61%), Positives = 44/55 (80%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L ++ S L + SHGS KL + Q+ TVEI+VKMDC+GC RKV+RAVEGMKG+ Sbjct: 1 MGAL-DHVSHLFDCSHGSSKLKRRKQLQTVEIKVKMDCEGCERKVRRAVEGMKGV 54 >ref|XP_006422591.1| hypothetical protein CICLE_v10029481mg [Citrus clementina] gi|568866801|ref|XP_006486737.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Citrus sinensis] gi|557524525|gb|ESR35831.1| hypothetical protein CICLE_v10029481mg [Citrus clementina] Length = 154 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/52 (57%), Positives = 42/52 (80%) Frame = -2 Query: 259 LMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 ++++FS + SHGS KL K Q+ TVE++V++DC+GC RKVKRAVEGMKG+ Sbjct: 3 VVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGV 54 >ref|XP_002534419.1| metal ion binding protein, putative [Ricinus communis] gi|223525324|gb|EEF27963.1| metal ion binding protein, putative [Ricinus communis] Length = 154 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/55 (61%), Positives = 44/55 (80%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L ++FS L + SHGS K K Q+ TVEI+V++DC+GC RKVKRAVEGMKG+ Sbjct: 1 MGAL-DHFSHLFDCSHGSSKHKKRKQLQTVEIKVRIDCEGCERKVKRAVEGMKGV 54 >ref|XP_006466995.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Citrus sinensis] Length = 158 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/54 (55%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = -2 Query: 256 MEYFSGLCNYS---HGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 +EY S LC++ H RKL K Q+ TVEI++KMDC+GC R+VK++VEGMKG+ Sbjct: 4 LEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGV 57 >gb|EXC16575.1| hypothetical protein L484_008381 [Morus notabilis] Length = 154 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L ++FS L + SHG KL + Q+ TVE++V++DC+GC RKVKRA+EGMKG+ Sbjct: 1 MGAL-DHFSYLFDCSHGRSKLKRRKQLQTVEVKVRLDCEGCERKVKRALEGMKGV 54 >ref|XP_004134849.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cucumis sativus] gi|449491302|ref|XP_004158855.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Cucumis sativus] Length = 159 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/55 (52%), Positives = 43/55 (78%), Gaps = 4/55 (7%) Frame = -2 Query: 256 MEYFSGLCNYSHG----SRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 +++ + +CN+SHG S+KL K Q+ VEI+VKMDC+GC +KVK++VEGMKG+ Sbjct: 4 LDHCADVCNFSHGHSHDSKKLKKNQQLQRVEIKVKMDCEGCQKKVKKSVEGMKGV 58 >ref|XP_002306185.1| GMFP7 family protein [Populus trichocarpa] gi|222849149|gb|EEE86696.1| GMFP7 family protein [Populus trichocarpa] Length = 154 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/55 (56%), Positives = 43/55 (78%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L ++ SG + S GS KL K Q+ TVE++V++DC+GC RKVKRA+EGMKG+ Sbjct: 1 MGAL-DHLSGFFDCSSGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRALEGMKGV 54 >ref|XP_006577898.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Glycine max] Length = 154 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 MG+L ++ S L + S GS K K Q+ TVE++VKMDC+GC RKV++AVEGMKG+N Sbjct: 1 MGAL-DHISELFDCSSGSSKHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVN 55 >ref|XP_003612216.1| Atfp6-like protein [Medicago truncatula] gi|355513551|gb|AES95174.1| Atfp6-like protein [Medicago truncatula] Length = 157 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSH--GSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L + S LC + H RKL+K NQ+ VEI+VKMDC+GC R+VK++VEGMKG+ Sbjct: 1 MGAL-DIISELCEFCHVHHGRKLVKRNQLQVVEIKVKMDCEGCERRVKKSVEGMKGV 56 >ref|XP_007041823.1| Farnesylated protein 6 isoform 1 [Theobroma cacao] gi|508705758|gb|EOX97654.1| Farnesylated protein 6 isoform 1 [Theobroma cacao] Length = 154 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L ++ S L + S S KL K Q+ TVEI+VKMDC+GC RKVK++VEGMKG+ Sbjct: 1 MGAL-DHVSDLFDCSRSSSKLKKRKQLQTVEIKVKMDCEGCERKVKKSVEGMKGV 54 >ref|XP_002272585.1| PREDICTED: uncharacterized protein LOC100261510 [Vitis vinifera] Length = 160 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/60 (56%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -2 Query: 268 MGSLMEYFSGLCNYS--HGSR---KLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L +YFS LC H SR KL K Q+ TVEI+VKMDC+GC R+V+++VEGMKG+ Sbjct: 1 MGAL-DYFSNLCECRSLHESRQLHKLRKLKQLQTVEIKVKMDCEGCERQVRKSVEGMKGV 59 >ref|XP_002272623.1| PREDICTED: uncharacterized protein LOC100256423 [Vitis vinifera] Length = 160 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/60 (56%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -2 Query: 268 MGSLMEYFSGLCNYS--HGSR---KLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L +YFS LC H SR KL K Q+ TVEI+VKMDC+GC R+V+++VEGMKG+ Sbjct: 1 MGAL-DYFSNLCECRSLHESRQLHKLRKLKQLQTVEIKVKMDCEGCERQVRKSVEGMKGV 59 >ref|XP_006282751.1| hypothetical protein CARUB_v10005941mg [Capsella rubella] gi|482551456|gb|EOA15649.1| hypothetical protein CARUB_v10005941mg [Capsella rubella] Length = 153 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = -2 Query: 259 LMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 ++++ S + + SHG K+ K Q+ TVEI+VKMDC+GC RKV+R+VEGMKG++ Sbjct: 3 VLDHVSDMFDCSHG-HKIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVS 54 >ref|XP_006411650.1| hypothetical protein EUTSA_v10026471mg [Eutrema salsugineum] gi|557112820|gb|ESQ53103.1| hypothetical protein EUTSA_v10026471mg [Eutrema salsugineum] Length = 153 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = -2 Query: 259 LMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 ++++ S + + SHG K+ K Q+ TVEI+VKMDC+GC RKV+R+VEGMKG++ Sbjct: 3 VLDHVSEMFDCSHG-HKIKKRRQLQTVEIKVKMDCEGCERKVRRSVEGMKGVS 54 >ref|NP_195570.1| farnesylated protein 6 [Arabidopsis thaliana] gi|75213637|sp|Q9SZN7.1|HIP26_ARATH RecName: Full=Heavy metal-associated isoprenylated plant protein 26; Short=AtHIPP26; AltName: Full=Farnesylated protein 6; Short=AtFP6; Flags: Precursor gi|11692850|gb|AAG40028.1|AF324677_1 AT4g38580 [Arabidopsis thaliana] gi|11908068|gb|AAG41463.1|AF326881_1 putative farnesylated protein [Arabidopsis thaliana] gi|12642882|gb|AAK00383.1|AF339701_1 putative farnesylated protein ATFP6 [Arabidopsis thaliana] gi|14190521|gb|AAK55741.1|AF380660_1 AT4g38580/F20M13_140 [Arabidopsis thaliana] gi|4467145|emb|CAB37514.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] gi|7270841|emb|CAB80522.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] gi|15810115|gb|AAL06983.1| AT4g38580/F20M13_140 [Arabidopsis thaliana] gi|332661550|gb|AEE86950.1| farnesylated protein 6 [Arabidopsis thaliana] Length = 153 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = -2 Query: 259 LMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 ++++ S + + SHG K+ K Q+ TVEI+VKMDC+GC RKV+R+VEGMKG++ Sbjct: 3 VLDHVSEMFDCSHG-HKIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVS 54 >gb|AAM60879.1| farnesylated protein (ATFP6) [Arabidopsis thaliana] Length = 153 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/53 (52%), Positives = 42/53 (79%) Frame = -2 Query: 259 LMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 ++++ S + + SHG K+ K Q+ TVEI+VKMDC+GC RKV+R+VEGMKG++ Sbjct: 3 VLDHVSEMFDCSHG-HKIKKRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVS 54 >ref|XP_007201826.1| hypothetical protein PRUPE_ppa012801mg [Prunus persica] gi|462397226|gb|EMJ03025.1| hypothetical protein PRUPE_ppa012801mg [Prunus persica] Length = 154 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGI 104 MG+L ++ S L + S GS + K Q TVEI+VKMDC+GC RKV+R+VEGMKG+ Sbjct: 1 MGAL-DHLSDLFDCSGGSSRHRKRKQFQTVEIKVKMDCEGCERKVRRSVEGMKGV 54 >gb|AFK45838.1| unknown [Lotus japonicus] Length = 153 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 268 MGSLMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 MG+L ++ S L + S GS K Q+ TVE++VKMDCDGC RKV++AVEGMKG+N Sbjct: 1 MGAL-DHISDLFDCSSGSSH-KKRKQLQTVEVKVKMDCDGCERKVRKAVEGMKGVN 54 >gb|ABK95274.1| unknown [Populus trichocarpa] Length = 154 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/53 (45%), Positives = 42/53 (79%) Frame = -2 Query: 259 LMEYFSGLCNYSHGSRKLMKTNQMTTVEIRVKMDCDGCVRKVKRAVEGMKGIN 101 ++++ SG+ + S GS + K Q+ TVE+++++DC+GC RKVKR++EGMKG++ Sbjct: 3 VLDHMSGIFDCSRGSSRHRKYRQLQTVEVKIRLDCEGCERKVKRSLEGMKGVS 55