BLASTX nr result
ID: Akebia27_contig00004662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00004662 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159451.1| hypothetical protein PHAVU_002G238700g [Phas... 57 2e-06 ref|XP_002272922.1| PREDICTED: uncharacterized protein LOC100265... 57 2e-06 ref|XP_004293948.1| PREDICTED: uncharacterized protein LOC101296... 56 5e-06 ref|XP_007025372.1| Uncharacterized protein TCM_029694 [Theobrom... 56 6e-06 >ref|XP_007159451.1| hypothetical protein PHAVU_002G238700g [Phaseolus vulgaris] gi|561032866|gb|ESW31445.1| hypothetical protein PHAVU_002G238700g [Phaseolus vulgaris] Length = 168 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 358 SLTMTKLLISDQYLTEILSEKISSQXXXXXXXXXXXRPHLESISEMPTDL 209 SLTMT LL+SD+YLT+ILSEK+S+Q RPHLESISE P+ L Sbjct: 119 SLTMTSLLVSDRYLTDILSEKVSTQRERRRGRVAVWRPHLESISESPSHL 168 >ref|XP_002272922.1| PREDICTED: uncharacterized protein LOC100265230 [Vitis vinifera] Length = 182 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/51 (58%), Positives = 38/51 (74%) Frame = -3 Query: 361 SSLTMTKLLISDQYLTEILSEKISSQXXXXXXXXXXXRPHLESISEMPTDL 209 ++++MT LLISD+YL+EILSEKIS+Q RPHLESISE P+DL Sbjct: 132 NTISMTNLLISDRYLSEILSEKISTQRDRRRGRVGVWRPHLESISETPSDL 182 >ref|XP_004293948.1| PREDICTED: uncharacterized protein LOC101296184 [Fragaria vesca subsp. vesca] Length = 169 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -3 Query: 361 SSLTMTKLLISDQYLTEILSEKISSQXXXXXXXXXXXRPHLESISEMPTDL 209 +S+ MT LLISDQYL+EILSEK+S+Q RPHLESI E P+D+ Sbjct: 119 NSIAMTNLLISDQYLSEILSEKVSTQRDRRRGRVGVWRPHLESICESPSDV 169 >ref|XP_007025372.1| Uncharacterized protein TCM_029694 [Theobroma cacao] gi|508780738|gb|EOY27994.1| Uncharacterized protein TCM_029694 [Theobroma cacao] Length = 197 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -3 Query: 361 SSLTMTKLLISDQYLTEILSEKISSQXXXXXXXXXXXRPHLESISEMPTD 212 +S++M+ LLISDQYL+EILSEK+S+Q RPHLESISE P D Sbjct: 147 NSISMSNLLISDQYLSEILSEKLSTQRDRRRGRVGVWRPHLESISETPND 196