BLASTX nr result
ID: Akebia27_contig00003915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00003915 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 102 4e-20 ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citr... 100 2e-19 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 100 2e-19 ref|XP_006473187.1| PREDICTED: mitochondrial import receptor sub... 99 8e-19 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 97 2e-18 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 97 2e-18 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 97 3e-18 gb|AFK44684.1| unknown [Lotus japonicus] 94 1e-17 ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citr... 94 3e-17 ref|XP_006477861.1| PREDICTED: mitochondrial import receptor sub... 93 3e-17 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 93 3e-17 ref|XP_004503550.1| PREDICTED: mitochondrial import receptor sub... 92 6e-17 gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Mor... 92 1e-16 ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 f... 91 1e-16 ref|XP_007160221.1| hypothetical protein PHAVU_002G303100g [Phas... 90 3e-16 ref|XP_004299770.1| PREDICTED: mitochondrial import receptor sub... 90 4e-16 ref|XP_002308124.1| Mitochondrial import receptor subunit TOM7 f... 89 5e-16 gb|ABK21382.1| unknown [Picea sitchensis] 89 8e-16 gb|AFK43929.1| unknown [Medicago truncatula] gi|388517719|gb|AFK... 88 1e-15 gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Mimulus... 88 1e-15 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Vitis vinifera] Length = 73 Score = 102 bits (255), Expect = 4e-20 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 SE STAKCLK+WS WA+KKAKVITHYGFIP+VIIIGMNSEPKPQLYQLLSPV Sbjct: 21 SEGHSTAKCLKDWSNWALKKAKVITHYGFIPMVIIIGMNSEPKPQLYQLLSPV 73 >ref|XP_006434603.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|567884091|ref|XP_006434604.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536725|gb|ESR47843.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gi|557536726|gb|ESR47844.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 100 bits (249), Expect = 2e-19 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 445 DRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 ++S A CLKEWSTWAMKKAKVITHYGFIPLVIIIGMNS+PKPQLYQLLSPV Sbjct: 21 EKSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQLLSPV 71 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 100 bits (249), Expect = 2e-19 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -2 Query: 448 EDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 E++ST +CLKEWSTW +KKAKVITHYGFIPLV+IIGMNSEPKPQLYQLL+PV Sbjct: 24 EEKSTIQCLKEWSTWTLKKAKVITHYGFIPLVVIIGMNSEPKPQLYQLLTPV 75 >ref|XP_006473187.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 71 Score = 98.6 bits (244), Expect = 8e-19 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -2 Query: 445 DRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 ++S A CLKEWSTWAMKKAKVITHYGFIPLVIIIGMNS+PKPQL+QLLSPV Sbjct: 21 EKSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 +EDRS ++CLKEW+TWAM+KAKVITHYGFIPLVIIIGMNS+PKP L QLLSPV Sbjct: 20 AEDRSASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] Length = 72 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 +EDRS ++CLKEW+TWAM+KAKVITHYGFIPLVI+IGMNS+PKP L QLLSPV Sbjct: 20 AEDRSASECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 96.7 bits (239), Expect = 3e-18 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 S++RS A+ +KEWSTWAMKKAKV+THYGFIPL+I+IGMNSEPKPQL QLLSPV Sbjct: 21 SDERSVAQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 94.4 bits (233), Expect = 1e-17 Identities = 40/53 (75%), Positives = 49/53 (92%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 SE+++ +CLKEW+TW M+KAKV+THYGFIPL+IIIGMNS+PKPQL QLLSPV Sbjct: 20 SEEKTACECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_006442420.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] gi|557544682|gb|ESR55660.1| hypothetical protein CICLE_v10023194mg [Citrus clementina] Length = 72 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 SE++S KEWSTW MKKAKV+THYGFIPL+IIIGMNS+PKPQ+YQLLSPV Sbjct: 20 SEEKSMVDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_006477861.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] Length = 72 Score = 93.2 bits (230), Expect = 3e-17 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 SE++S KEWSTW MKKAKV+THYGFIPL+IIIGMNS+PKPQ+YQLLSPV Sbjct: 20 SEEKSMIDSFKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 72 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 SE++S + KEW+TWA+KKAKV+THYGFIPLVIIIGMNSEPKPQL QLLSPV Sbjct: 21 SEEKSATQAFKEWTTWAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_004503550.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cicer arietinum] Length = 72 Score = 92.4 bits (228), Expect = 6e-17 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 +EDRS C+KEW+TW ++KAKVITHYGFIP++I+IGMNS+PKPQL QLLSPV Sbjct: 20 TEDRSYVDCMKEWTTWGLRKAKVITHYGFIPMIILIGMNSDPKPQLSQLLSPV 72 >gb|EXC12836.1| Mitochondrial import receptor subunit TOM7-1 [Morus notabilis] Length = 71 Score = 91.7 bits (226), Expect = 1e-16 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = -2 Query: 448 EDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 E++STA+ +KEW+TWA KKAKVITHYGFIPLVIIIGMNS+PKP L QLLSPV Sbjct: 20 EEKSTAQLVKEWTTWAAKKAKVITHYGFIPLVIIIGMNSDPKPHLSQLLSPV 71 >ref|XP_006372198.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|550318729|gb|ERP49995.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 91.3 bits (225), Expect = 1e-16 Identities = 39/51 (76%), Positives = 47/51 (92%) Frame = -2 Query: 448 EDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSP 296 E++S ++ +KEWSTW KKAKVITHYGFIP++IIIGMNSEPKPQ+YQLLSP Sbjct: 23 EEKSASQYVKEWSTWTFKKAKVITHYGFIPMIIIIGMNSEPKPQIYQLLSP 73 >ref|XP_007160221.1| hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] gi|561033636|gb|ESW32215.1| hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] Length = 72 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -2 Query: 448 EDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 EDRS ++ LKEW+TW M+KAKVITHYGFIPLVIIIGMNS+PKP L QL SPV Sbjct: 21 EDRSVSESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPKPALSQLFSPV 72 >ref|XP_004299770.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/53 (73%), Positives = 47/53 (88%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 S++RS + +KEW+ W MKKAKV+THYGFIPL+IIIGMNS+PKPQL QLLSPV Sbjct: 21 SDERSITQAVKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_002308124.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] gi|222854100|gb|EEE91647.1| Mitochondrial import receptor subunit TOM7 family protein [Populus trichocarpa] Length = 74 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = -2 Query: 448 EDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSP 296 E++S ++ KEWSTW+ KKAKVITHYGFIP++IIIGMNSEPKPQ++QLLSP Sbjct: 23 EEKSASQYFKEWSTWSFKKAKVITHYGFIPMIIIIGMNSEPKPQIHQLLSP 73 >gb|ABK21382.1| unknown [Picea sitchensis] Length = 72 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 448 EDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 E RS K +KEW+TW MK+AK +THYGFIPLVIIIGMNSEPKP + QLLSPV Sbjct: 21 ESRSATKAVKEWTTWVMKRAKTVTHYGFIPLVIIIGMNSEPKPSIAQLLSPV 72 >gb|AFK43929.1| unknown [Medicago truncatula] gi|388517719|gb|AFK46921.1| unknown [Medicago truncatula] Length = 70 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -2 Query: 451 SEDRSTAKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 +EDRS +KEW+TW MKK KVI HYGFIPL+IIIGMNS+PKPQ+ QLLSPV Sbjct: 18 AEDRSVIDSVKEWTTWGMKKTKVIAHYGFIPLIIIIGMNSDPKPQISQLLSPV 70 >gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Mimulus guttatus] Length = 78 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -2 Query: 433 AKCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLSPV 293 AK +KEWSTW MKKAKVITHYGFIPLVIIIGMNS+PKP L QLLSPV Sbjct: 32 AKFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78