BLASTX nr result
ID: Akebia27_contig00003216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00003216 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557091.2| PREDICTED: auxin transporter-like protein 2-... 72 1e-10 ref|XP_006349465.1| PREDICTED: auxin transporter-like protein 2-... 68 2e-09 ref|NP_001234688.1| LAX4 protein [Solanum lycopersicum] gi|33727... 68 2e-09 gb|ABF46821.1| putative auxin permease protein 1 [Fagus sylvatica] 68 2e-09 gb|AEQ61904.1| auxin influx transport protein [Salvia miltiorrhiza] 67 2e-09 ref|XP_002268925.1| PREDICTED: auxin transporter-like protein 2 ... 67 2e-09 emb|CAN76469.1| hypothetical protein VITISV_030043 [Vitis vinifera] 67 2e-09 gb|EYU28490.1| hypothetical protein MIMGU_mgv1a005429mg [Mimulus... 67 3e-09 gb|EYU26651.1| hypothetical protein MIMGU_mgv1a0066981mg, partia... 67 3e-09 gb|EXB58191.1| hypothetical protein L484_026394 [Morus notabilis] 67 3e-09 ref|XP_006602646.1| PREDICTED: auxin transporter-like protein 2-... 67 3e-09 ref|XP_006366358.1| PREDICTED: auxin transporter-like protein 2-... 67 3e-09 ref|XP_007140373.1| hypothetical protein PHAVU_008G106300g [Phas... 67 3e-09 ref|XP_004492419.1| PREDICTED: auxin transporter-like protein 2-... 67 3e-09 dbj|BAC98948.1| AUX1-like auxin influx carrier protein [Pisum sa... 67 3e-09 ref|XP_006583631.1| PREDICTED: auxin transporter-like protein 2-... 67 3e-09 ref|XP_003520808.1| PREDICTED: auxin transporter-like protein 2-... 67 3e-09 ref|XP_003516350.1| PREDICTED: auxin transporter-like protein 4-... 67 3e-09 ref|NP_001233919.1| LAX1 protein [Solanum lycopersicum] gi|33727... 67 3e-09 ref|XP_002526879.1| amino acid transporter, putative [Ricinus co... 67 3e-09 >ref|XP_003557091.2| PREDICTED: auxin transporter-like protein 2-like, partial [Glycine max] Length = 240 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 104 CYREIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 C REIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 7 CCREIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 40 >ref|XP_006349465.1| PREDICTED: auxin transporter-like protein 2-like [Solanum tuberosum] Length = 485 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA Sbjct: 254 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 284 >ref|NP_001234688.1| LAX4 protein [Solanum lycopersicum] gi|337271826|gb|AEI69671.1| LAX4 protein [Solanum lycopersicum] Length = 485 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA Sbjct: 254 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 284 >gb|ABF46821.1| putative auxin permease protein 1 [Fagus sylvatica] Length = 403 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA Sbjct: 211 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 241 >gb|AEQ61904.1| auxin influx transport protein [Salvia miltiorrhiza] Length = 487 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 257 EIMHAMWKPQKFKYIYLVATLYVFTLTIPSA 287 >ref|XP_002268925.1| PREDICTED: auxin transporter-like protein 2 [Vitis vinifera] gi|297736635|emb|CBI25506.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 251 EIMHAMWKPQKFKYIYLVATLYVFTLTIPSA 281 >emb|CAN76469.1| hypothetical protein VITISV_030043 [Vitis vinifera] Length = 872 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 589 EIMHAMWKPQKFKYIYLVATLYVFTLTIPSA 619 >gb|EYU28490.1| hypothetical protein MIMGU_mgv1a005429mg [Mimulus guttatus] Length = 484 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 258 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 288 >gb|EYU26651.1| hypothetical protein MIMGU_mgv1a0066981mg, partial [Mimulus guttatus] Length = 310 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 84 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 114 >gb|EXB58191.1| hypothetical protein L484_026394 [Morus notabilis] Length = 482 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 254 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 284 >ref|XP_006602646.1| PREDICTED: auxin transporter-like protein 2-like isoform X2 [Glycine max] gi|571547425|ref|XP_006602647.1| PREDICTED: auxin transporter-like protein 2-like isoform X3 [Glycine max] gi|571547429|ref|XP_003552233.2| PREDICTED: auxin transporter-like protein 2-like isoform X1 [Glycine max] Length = 494 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 261 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 291 >ref|XP_006366358.1| PREDICTED: auxin transporter-like protein 2-like [Solanum tuberosum] Length = 481 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYLIATLYVFTLT+PSA Sbjct: 255 EIMHAMWKPQKFKYIYLIATLYVFTLTLPSA 285 >ref|XP_007140373.1| hypothetical protein PHAVU_008G106300g [Phaseolus vulgaris] gi|561013506|gb|ESW12367.1| hypothetical protein PHAVU_008G106300g [Phaseolus vulgaris] Length = 491 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 259 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 289 >ref|XP_004492419.1| PREDICTED: auxin transporter-like protein 2-like [Cicer arietinum] Length = 489 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 257 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 287 >dbj|BAC98948.1| AUX1-like auxin influx carrier protein [Pisum sativum] gi|224434586|dbj|BAH23797.1| putative auxin transport facilitator protein [Pisum sativum] Length = 487 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 256 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 286 >ref|XP_006583631.1| PREDICTED: auxin transporter-like protein 2-like isoform X1 [Glycine max] gi|571466343|ref|XP_006583632.1| PREDICTED: auxin transporter-like protein 2-like isoform X2 [Glycine max] gi|571466345|ref|XP_006583633.1| PREDICTED: auxin transporter-like protein 2-like isoform X3 [Glycine max] gi|571466347|ref|XP_006583634.1| PREDICTED: auxin transporter-like protein 2-like isoform X4 [Glycine max] gi|571466349|ref|XP_006583635.1| PREDICTED: auxin transporter-like protein 2-like isoform X5 [Glycine max] Length = 494 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 261 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 291 >ref|XP_003520808.1| PREDICTED: auxin transporter-like protein 2-like [Glycine max] Length = 483 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 253 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 283 >ref|XP_003516350.1| PREDICTED: auxin transporter-like protein 4-like [Glycine max] Length = 409 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 253 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 283 >ref|NP_001233919.1| LAX1 protein [Solanum lycopersicum] gi|337271820|gb|AEI69668.1| LAX1 protein [Solanum lycopersicum] Length = 487 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYLIATLYVFTLT+PSA Sbjct: 255 EIMHAMWKPQKFKYIYLIATLYVFTLTLPSA 285 >ref|XP_002526879.1| amino acid transporter, putative [Ricinus communis] gi|223533778|gb|EEF35510.1| amino acid transporter, putative [Ricinus communis] Length = 472 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 95 EIMHAMWKPQKFKYIYLIATLYVFTLTIPSA 3 EIMHAMWKPQKFKYIYL+ATLYVFTLTIPSA Sbjct: 253 EIMHAMWKPQKFKYIYLLATLYVFTLTIPSA 283