BLASTX nr result
ID: Akebia27_contig00002587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00002587 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045417.1| BRI1-like 2 [Theobroma cacao] gi|508709352|g... 71 2e-10 gb|EXC05026.1| Serine/threonine-protein kinase BRI1-like 2 [Moru... 70 2e-10 ref|XP_006470906.1| PREDICTED: serine/threonine-protein kinase B... 70 2e-10 ref|XP_006420663.1| hypothetical protein CICLE_v10004191mg [Citr... 70 2e-10 ref|XP_007224892.1| hypothetical protein PRUPE_ppa022290mg [Prun... 70 2e-10 ref|XP_004150152.1| PREDICTED: serine/threonine-protein kinase B... 70 2e-10 ref|XP_002521903.1| serine/threonine-protein kinase bri1, putati... 70 2e-10 ref|XP_006355026.1| PREDICTED: serine/threonine-protein kinase B... 70 4e-10 ref|XP_004236904.1| PREDICTED: serine/threonine-protein kinase B... 70 4e-10 emb|CBI26771.3| unnamed protein product [Vitis vinifera] 70 4e-10 ref|XP_002281730.1| PREDICTED: serine/threonine-protein kinase B... 70 4e-10 emb|CAN60090.1| hypothetical protein VITISV_033419 [Vitis vinifera] 70 4e-10 ref|XP_006585065.1| PREDICTED: serine/threonine-protein kinase B... 68 1e-09 ref|XP_007158820.1| hypothetical protein PHAVU_002G184800g [Phas... 67 3e-09 gb|ACM89468.1| ATP-binding/protein serine/threonine kinase [Glyc... 67 3e-09 ref|NP_001237994.1| ATP binding/protein serine/threonine kinase ... 67 3e-09 ref|XP_002312487.1| leucine-rich repeat transmembrane protein ki... 67 3e-09 ref|XP_004504609.1| PREDICTED: serine/threonine-protein kinase B... 66 4e-09 ref|XP_004300048.1| PREDICTED: serine/threonine-protein kinase B... 66 4e-09 gb|EYU30190.1| hypothetical protein MIMGU_mgv1a025141mg [Mimulus... 64 2e-08 >ref|XP_007045417.1| BRI1-like 2 [Theobroma cacao] gi|508709352|gb|EOY01249.1| BRI1-like 2 [Theobroma cacao] Length = 1134 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEMMRYLEIT+QCV+DFPSKRPNMLQ V +LRELMP Sbjct: 1088 VKEMMRYLEITLQCVDDFPSKRPNMLQVVALLRELMP 1124 >gb|EXC05026.1| Serine/threonine-protein kinase BRI1-like 2 [Morus notabilis] Length = 1137 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+DFPSKRPNMLQ V MLRELMP Sbjct: 1091 VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRELMP 1127 >ref|XP_006470906.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Citrus sinensis] Length = 1135 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+DFPSKRPNMLQ V MLRELMP Sbjct: 1089 VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRELMP 1125 >ref|XP_006420663.1| hypothetical protein CICLE_v10004191mg [Citrus clementina] gi|557522536|gb|ESR33903.1| hypothetical protein CICLE_v10004191mg [Citrus clementina] Length = 1135 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+DFPSKRPNMLQ V MLRELMP Sbjct: 1089 VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRELMP 1125 >ref|XP_007224892.1| hypothetical protein PRUPE_ppa022290mg [Prunus persica] gi|462421828|gb|EMJ26091.1| hypothetical protein PRUPE_ppa022290mg [Prunus persica] Length = 1136 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+DFPSKRPNMLQ V MLRELMP Sbjct: 1090 VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRELMP 1126 >ref|XP_004150152.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Cucumis sativus] gi|449520831|ref|XP_004167436.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Cucumis sativus] Length = 1157 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT++CVE+FPSKRPNMLQ VTMLRELMP Sbjct: 1111 VKEMVRYLEITLRCVEEFPSKRPNMLQVVTMLRELMP 1147 >ref|XP_002521903.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223538941|gb|EEF40539.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Length = 1140 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+DFPSKRPNMLQ V MLRELMP Sbjct: 1094 VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRELMP 1130 >ref|XP_006355026.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Solanum tuberosum] Length = 1126 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEITMQCVEDF SKRPNMLQ V MLRELMP Sbjct: 1082 VKEMVRYLEITMQCVEDFASKRPNMLQVVAMLRELMP 1118 >ref|XP_004236904.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Solanum lycopersicum] Length = 1126 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEITMQCVEDF SKRPNMLQ V MLRELMP Sbjct: 1082 VKEMVRYLEITMQCVEDFASKRPNMLQVVAMLRELMP 1118 >emb|CBI26771.3| unnamed protein product [Vitis vinifera] Length = 980 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 V EM+RYL+ITMQCVEDFPSKRPNMLQAV MLREL+P Sbjct: 910 VNEMVRYLDITMQCVEDFPSKRPNMLQAVAMLRELIP 946 >ref|XP_002281730.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2 [Vitis vinifera] Length = 1134 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 V EM+RYL+ITMQCVEDFPSKRPNMLQAV MLREL+P Sbjct: 1089 VNEMVRYLDITMQCVEDFPSKRPNMLQAVAMLRELIP 1125 >emb|CAN60090.1| hypothetical protein VITISV_033419 [Vitis vinifera] Length = 941 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 V EM+RYL+ITMQCVEDFPSKRPNMLQAV MLREL+P Sbjct: 896 VNEMVRYLDITMQCVEDFPSKRPNMLQAVAMLRELIP 932 >ref|XP_006585065.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Glycine max] Length = 1136 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEITMQCV+D PS+RPNMLQ V MLRELMP Sbjct: 1090 VKEMIRYLEITMQCVDDLPSRRPNMLQVVAMLRELMP 1126 >ref|XP_007158820.1| hypothetical protein PHAVU_002G184800g [Phaseolus vulgaris] gi|561032235|gb|ESW30814.1| hypothetical protein PHAVU_002G184800g [Phaseolus vulgaris] Length = 1132 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+D PS+RPNMLQ V MLRELMP Sbjct: 1086 VKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELMP 1122 >gb|ACM89468.1| ATP-binding/protein serine/threonine kinase [Glycine max] Length = 1086 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+D PS+RPNMLQ V MLRELMP Sbjct: 1040 VKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELMP 1076 >ref|NP_001237994.1| ATP binding/protein serine/threonine kinase [Glycine max] gi|212717135|gb|ACJ37409.1| ATP binding/protein serine/threonine kinase [Glycine max] Length = 1173 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEIT+QCV+D PS+RPNMLQ V MLRELMP Sbjct: 1127 VKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELMP 1163 >ref|XP_002312487.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222852307|gb|EEE89854.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 1134 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLEI++QCV+DFPSKRP+MLQ V MLRELMP Sbjct: 1088 VKEMVRYLEISLQCVDDFPSKRPSMLQVVAMLRELMP 1124 >ref|XP_004504609.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Cicer arietinum] Length = 1140 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLE+T+QCV+D PSKRPNMLQ V MLREL+P Sbjct: 1094 VKEMIRYLEVTLQCVDDLPSKRPNMLQVVAMLRELIP 1130 >ref|XP_004300048.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Fragaria vesca subsp. vesca] Length = 1089 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLRELMP 112 VKEM+RYLE+T++CV+DFPS+RPNMLQ V +LRELMP Sbjct: 1043 VKEMVRYLEVTLRCVDDFPSRRPNMLQVVALLRELMP 1079 >gb|EYU30190.1| hypothetical protein MIMGU_mgv1a025141mg [Mimulus guttatus] Length = 1141 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 VKEMMRYLEITMQCVEDFPSKRPNMLQAVTMLREL 106 VKEM+RYLEIT+QCV+DFPSKRP+MLQ V MLREL Sbjct: 1088 VKEMVRYLEITLQCVDDFPSKRPSMLQVVAMLREL 1122