BLASTX nr result
ID: Akebia27_contig00001723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00001723 (759 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836191.1| hypothetical protein AMTR_s00101p00071870 [A... 61 5e-07 >ref|XP_006836191.1| hypothetical protein AMTR_s00101p00071870 [Amborella trichopoda] gi|548838691|gb|ERM99044.1| hypothetical protein AMTR_s00101p00071870 [Amborella trichopoda] Length = 394 Score = 60.8 bits (146), Expect = 5e-07 Identities = 35/64 (54%), Positives = 40/64 (62%) Frame = +3 Query: 27 SARSLAKSYTPIAGSYLAHSHD*KRTASIPCRNPRSADELLVGVHLSTQSTPPFNTKS*L 206 SARSLA S TP AGSYLAHS R + I S +E L+G +STQS PP NTK+ L Sbjct: 192 SARSLASSATPTAGSYLAHS----RASPITLLQQHSVEEPLLGAFVSTQSAPPLNTKNML 247 Query: 207 CVVS 218 C S Sbjct: 248 CSFS 251