BLASTX nr result
ID: Akebia27_contig00001016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia27_contig00001016 (1313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27863.3| unnamed protein product [Vitis vinifera] 64 2e-07 ref|XP_002280579.1| PREDICTED: uncharacterized membrane protein ... 64 2e-07 emb|CAN67685.1| hypothetical protein VITISV_009914 [Vitis vinifera] 64 2e-07 ref|XP_006403089.1| hypothetical protein EUTSA_v10003454mg [Eutr... 63 3e-07 ref|XP_006843157.1| hypothetical protein AMTR_s00146p00041410 [A... 63 3e-07 gb|EYU28355.1| hypothetical protein MIMGU_mgv1a007989mg [Mimulus... 63 3e-07 gb|EXB38903.1| hypothetical protein L484_027338 [Morus notabilis] 62 4e-07 ref|XP_007202150.1| hypothetical protein PRUPE_ppa007084mg [Prun... 62 4e-07 ref|XP_006478076.1| PREDICTED: uncharacterized membrane protein ... 62 6e-07 ref|XP_006441285.1| hypothetical protein CICLE_v10020772mg [Citr... 62 6e-07 ref|XP_006441284.1| hypothetical protein CICLE_v10020772mg [Citr... 62 6e-07 ref|XP_006283919.1| hypothetical protein CARUB_v10005037mg [Caps... 62 6e-07 ref|NP_198396.1| uncharacterized protein [Arabidopsis thaliana] ... 62 6e-07 ref|XP_002868421.1| hypothetical protein ARALYDRAFT_915673 [Arab... 62 6e-07 ref|XP_002308273.1| hypothetical protein POPTR_0006s14780g [Popu... 62 6e-07 ref|XP_002324182.1| hypothetical protein POPTR_0018s05390g [Popu... 62 6e-07 ref|XP_007012723.1| Uncharacterized protein isoform 2, partial [... 62 7e-07 ref|XP_007012722.1| Uncharacterized protein isoform 1 [Theobroma... 62 7e-07 ref|XP_004287598.1| PREDICTED: uncharacterized membrane protein ... 62 7e-07 ref|XP_007202149.1| hypothetical protein PRUPE_ppa007084mg [Prun... 62 7e-07 >emb|CBI27863.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 63.5 bits (153), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV+LLLY +NEKLFMVCFSFAE Sbjct: 122 DFCYYANTIFLVVLLLYPKNEKLFMVCFSFAE 153 >ref|XP_002280579.1| PREDICTED: uncharacterized membrane protein C776.05-like [Vitis vinifera] Length = 408 Score = 63.5 bits (153), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV+LLLY +NEKLFMVCFSFAE Sbjct: 122 DFCYYANTIFLVVLLLYPKNEKLFMVCFSFAE 153 >emb|CAN67685.1| hypothetical protein VITISV_009914 [Vitis vinifera] Length = 368 Score = 63.5 bits (153), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV+LLLY +NEKLFMVCFSFAE Sbjct: 82 DFCYYANTIFLVVLLLYPKNEKLFMVCFSFAE 113 >ref|XP_006403089.1| hypothetical protein EUTSA_v10003454mg [Eutrema salsugineum] gi|557104196|gb|ESQ44542.1| hypothetical protein EUTSA_v10003454mg [Eutrema salsugineum] Length = 415 Score = 63.2 bits (152), Expect = 3e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY RNEKLFMVCFSFAE Sbjct: 162 DFCYYANTIFLVDLLLYPRNEKLFMVCFSFAE 193 >ref|XP_006843157.1| hypothetical protein AMTR_s00146p00041410 [Amborella trichopoda] gi|548845381|gb|ERN04832.1| hypothetical protein AMTR_s00146p00041410 [Amborella trichopoda] Length = 377 Score = 63.2 bits (152), Expect = 3e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFL MLLLY +NEKLFMVCFSFAE Sbjct: 103 DFCYYANTIFLFMLLLYPKNEKLFMVCFSFAE 134 >gb|EYU28355.1| hypothetical protein MIMGU_mgv1a007989mg [Mimulus guttatus] Length = 388 Score = 62.8 bits (151), Expect = 3e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFL+MLL Y +NEKLFMVCFSFAE Sbjct: 121 DFCYYANTIFLIMLLCYPKNEKLFMVCFSFAE 152 >gb|EXB38903.1| hypothetical protein L484_027338 [Morus notabilis] Length = 395 Score = 62.4 bits (150), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 122 DFCYYANTIFLVHLLLYPKNEKLFMVCFSFAE 153 >ref|XP_007202150.1| hypothetical protein PRUPE_ppa007084mg [Prunus persica] gi|462397681|gb|EMJ03349.1| hypothetical protein PRUPE_ppa007084mg [Prunus persica] Length = 383 Score = 62.4 bits (150), Expect = 4e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAEVSALS 902 DFCYY NTIFLV LLLY RNEK FMVCFSFAE L+ Sbjct: 122 DFCYYANTIFLVDLLLYPRNEKFFMVCFSFAEQGPLA 158 >ref|XP_006478076.1| PREDICTED: uncharacterized membrane protein C776.05-like [Citrus sinensis] Length = 381 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 121 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 152 >ref|XP_006441285.1| hypothetical protein CICLE_v10020772mg [Citrus clementina] gi|557543547|gb|ESR54525.1| hypothetical protein CICLE_v10020772mg [Citrus clementina] Length = 362 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 121 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 152 >ref|XP_006441284.1| hypothetical protein CICLE_v10020772mg [Citrus clementina] gi|557543546|gb|ESR54524.1| hypothetical protein CICLE_v10020772mg [Citrus clementina] Length = 327 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 86 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 117 >ref|XP_006283919.1| hypothetical protein CARUB_v10005037mg [Capsella rubella] gi|482552624|gb|EOA16817.1| hypothetical protein CARUB_v10005037mg [Capsella rubella] Length = 382 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 125 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 156 >ref|NP_198396.1| uncharacterized protein [Arabidopsis thaliana] gi|9758147|dbj|BAB08704.1| unnamed protein product [Arabidopsis thaliana] gi|14335068|gb|AAK59798.1| AT5g35460/MOK9_4 [Arabidopsis thaliana] gi|27764924|gb|AAO23583.1| At5g35460/MOK9_4 [Arabidopsis thaliana] gi|332006586|gb|AED93969.1| uncharacterized protein AT5G35460 [Arabidopsis thaliana] Length = 381 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 121 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 152 >ref|XP_002868421.1| hypothetical protein ARALYDRAFT_915673 [Arabidopsis lyrata subsp. lyrata] gi|297314257|gb|EFH44680.1| hypothetical protein ARALYDRAFT_915673 [Arabidopsis lyrata subsp. lyrata] Length = 379 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 125 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 156 >ref|XP_002308273.1| hypothetical protein POPTR_0006s14780g [Populus trichocarpa] gi|222854249|gb|EEE91796.1| hypothetical protein POPTR_0006s14780g [Populus trichocarpa] Length = 377 Score = 62.0 bits (149), Expect = 6e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 1039 KSHTPVIYQDFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 KSH ++ DFCYY NTIFLV +LLY +NEKLFMVCFSFAE Sbjct: 107 KSHYYLL--DFCYYANTIFLVDILLYPKNEKLFMVCFSFAE 145 >ref|XP_002324182.1| hypothetical protein POPTR_0018s05390g [Populus trichocarpa] gi|118486934|gb|ABK95300.1| unknown [Populus trichocarpa] gi|222865616|gb|EEF02747.1| hypothetical protein POPTR_0018s05390g [Populus trichocarpa] Length = 384 Score = 62.0 bits (149), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY +NEKLFMVCFSFAE Sbjct: 125 DFCYYANTIFLVDLLLYPKNEKLFMVCFSFAE 156 >ref|XP_007012723.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] gi|508783086|gb|EOY30342.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] Length = 341 Score = 61.6 bits (148), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY RNEK FMVCFSFAE Sbjct: 158 DFCYYANTIFLVDLLLYPRNEKFFMVCFSFAE 189 >ref|XP_007012722.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783085|gb|EOY30341.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 385 Score = 61.6 bits (148), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY RNEK FMVCFSFAE Sbjct: 124 DFCYYANTIFLVDLLLYPRNEKFFMVCFSFAE 155 >ref|XP_004287598.1| PREDICTED: uncharacterized membrane protein C776.05-like [Fragaria vesca subsp. vesca] Length = 405 Score = 61.6 bits (148), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY RNEK FMVCFSFAE Sbjct: 129 DFCYYANTIFLVDLLLYPRNEKFFMVCFSFAE 160 >ref|XP_007202149.1| hypothetical protein PRUPE_ppa007084mg [Prunus persica] gi|462397680|gb|EMJ03348.1| hypothetical protein PRUPE_ppa007084mg [Prunus persica] Length = 382 Score = 61.6 bits (148), Expect = 7e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -2 Query: 1012 DFCYYTNTIFLVMLLLYHRNEKLFMVCFSFAE 917 DFCYY NTIFLV LLLY RNEK FMVCFSFAE Sbjct: 122 DFCYYANTIFLVDLLLYPRNEKFFMVCFSFAE 153