BLASTX nr result
ID: Akebia26_contig00040241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00040241 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006370981.1| hypothetical protein POPTR_0019s02340g [Popu... 59 7e-07 >ref|XP_006370981.1| hypothetical protein POPTR_0019s02340g [Populus trichocarpa] gi|550316564|gb|ERP48778.1| hypothetical protein POPTR_0019s02340g [Populus trichocarpa] Length = 116 Score = 58.9 bits (141), Expect = 7e-07 Identities = 41/97 (42%), Positives = 54/97 (55%), Gaps = 7/97 (7%) Frame = -3 Query: 293 MGSHRRNFFTVWIIFVVLISG--FNPLVESRCLDEDQWWKKG-GDIVIQSLAKGPSKPSG 123 MGS R+N IFV ++ G + ++ +R L+ +QW K+ G+I QSL +GP PSG Sbjct: 1 MGSQRKNQCLTMTIFVAIVFGPCSHQILAARPLEGEQWLKQNLGNI--QSLRRGPVPPSG 58 Query: 122 PSCDTTIPG---NHCPPAINSKNFAGHFPG-VSPAFP 24 S T IPG HCP + NFAGH PAFP Sbjct: 59 GSSCTHIPGRGSGHCP--LGEMNFAGHIVAHAPPAFP 93