BLASTX nr result
ID: Akebia26_contig00040104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00040104 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 55 1e-06 gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 55 8e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = -2 Query: 308 WSL*MSSCRMLCDRHISIKPKGKFYKTTLGPAMFYGVECGEI*KQYVHR*G 156 W S+ +LCDR + +K KGKFY+T + PAM YG EC + Q+VH+ G Sbjct: 822 WMKWKSASGVLCDRRMPLKLKGKFYRTAIRPAMLYGTECWAVKHQHVHKMG 872 Score = 22.7 bits (47), Expect(2) = 1e-06 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 162 MRMLRWVCTCVMKAK 118 MRMLRW+C K K Sbjct: 876 MRMLRWMCGHTRKDK 890 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -2 Query: 308 WSL*MSSCRMLCDRHISIKPKGKFYKTTLGPAMFYGVECGEI*KQYVHR*G 156 W S+ +LCDR + +K KGKFY+TT+ PAM YG EC + Q+VH+ G Sbjct: 48 WMKWKSASGVLCDRCMPLKLKGKFYRTTIRPAMLYGTECWAVKYQHVHKMG 98