BLASTX nr result
ID: Akebia26_contig00040009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00040009 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49036.1| hypothetical protein DOTSEDRAFT_40277 [Dothistrom... 64 2e-08 >gb|EME49036.1| hypothetical protein DOTSEDRAFT_40277 [Dothistroma septosporum NZE10] Length = 112 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 343 ESYLKQAQDGASNLAGQASETVNAGVKQAQDALGMN 236 E+YLKQAQDGA+NLA QASET++AGVKQAQDALG+N Sbjct: 72 ETYLKQAQDGAANLANQASETISAGVKQAQDALGLN 107