BLASTX nr result
ID: Akebia26_contig00039949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00039949 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007014264.1| Pentatricopeptide repeat-containing protein,... 70 3e-10 ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [A... 67 3e-09 ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_002866609.1| pentatricopeptide repeat-containing protein ... 62 8e-08 ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citr... 60 2e-07 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 60 2e-07 ref|XP_003617308.1| Auxin response factor [Medicago truncatula] ... 58 2e-06 gb|EPS58828.1| hypothetical protein M569_15985, partial [Genlise... 57 3e-06 ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 emb|CBI38482.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 57 3e-06 >ref|XP_007014264.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581139|ref|XP_007014265.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581142|ref|XP_007014266.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784627|gb|EOY31883.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784628|gb|EOY31884.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784629|gb|EOY31885.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 716 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/78 (46%), Positives = 50/78 (64%) Frame = +2 Query: 104 QSLVPGIDKEFSTKVNIHTHVCSSSGAGANSCLDTHRLGYENEWEELLKPFDIEDLKKSF 283 ++L + K + H VCSS ++ ++ ENEWE LLKPFD+++L+KSF Sbjct: 6 KNLALHVRKNLQSVSKTHFSVCSSKYYSKSNQSES-----ENEWERLLKPFDLDELRKSF 60 Query: 284 NWITPRQLCQMLELPLDV 337 N ITP QLC++LELPLDV Sbjct: 61 NKITPYQLCKLLELPLDV 78 >ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] gi|548839447|gb|ERM99736.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] Length = 712 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/73 (46%), Positives = 49/73 (67%), Gaps = 4/73 (5%) Frame = +2 Query: 131 EFSTKVNI---HTHVCSSSGAGAN-SCLDTHRLGYENEWEELLKPFDIEDLKKSFNWITP 298 +F T+ N+ H + C S A + HR ENEWE++LKPF +E+L+KSFN ITP Sbjct: 9 KFVTRKNLYSFHYYFCLISSCPAKLERIRDHRSSSENEWEKILKPFGLEELRKSFNRITP 68 Query: 299 RQLCQMLELPLDV 337 ++LC++L LPLD+ Sbjct: 69 QRLCKLLFLPLDL 81 >ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Cicer arietinum] gi|502151414|ref|XP_004508429.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Cicer arietinum] gi|502151416|ref|XP_004508430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Cicer arietinum] gi|502151418|ref|XP_004508431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X4 [Cicer arietinum] Length = 712 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/72 (40%), Positives = 44/72 (61%) Frame = +2 Query: 122 IDKEFSTKVNIHTHVCSSSGAGANSCLDTHRLGYENEWEELLKPFDIEDLKKSFNWITPR 301 + + S + IH+ S+ G N + + EWE +LKPFD++ L++S N ITP Sbjct: 11 VTRTISVCIKIHSFPLCSTALGKNFNDNEPETESDTEWERVLKPFDLKHLQRSLNPITPS 70 Query: 302 QLCQMLELPLDV 337 QLC++LELPLD+ Sbjct: 71 QLCKLLELPLDI 82 >ref|XP_002866609.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312444|gb|EFH42868.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 724 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = +2 Query: 167 CSSSGAGANSCLDTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 C S G D+ NEWE+LLKPFD++ L+ SF+ ITP QLC++LELPLDV Sbjct: 34 CGSGGDDGGGSPDS-----SNEWEKLLKPFDLDSLRNSFHKITPFQLCKLLELPLDV 85 >ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Citrus sinensis] gi|568867543|ref|XP_006487096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Citrus sinensis] Length = 728 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +2 Query: 176 SGAGANSCLDTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 S A S ++ ENEWE LLKPFD+ +L+KS + ITP QLC++L LPLDV Sbjct: 41 SNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDV 94 >ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] gi|557524968|gb|ESR36274.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] Length = 728 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/68 (47%), Positives = 41/68 (60%) Frame = +2 Query: 134 FSTKVNIHTHVCSSSGAGANSCLDTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQ 313 FS I C+ A S ++ ENEWE LLKPFD+ +L+KS + ITP QLC+ Sbjct: 32 FSNSCTIDYRNCT-----ARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCK 86 Query: 314 MLELPLDV 337 +L LPLDV Sbjct: 87 LLRLPLDV 94 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 224 ENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 E EWE LLKPFD+++L++SFN ITP QLC++L LPLDV Sbjct: 45 ETEWERLLKPFDLKELRRSFNQITPFQLCKLLLLPLDV 82 >ref|XP_003617308.1| Auxin response factor [Medicago truncatula] gi|355518643|gb|AET00267.1| Auxin response factor [Medicago truncatula] Length = 948 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/58 (46%), Positives = 39/58 (67%) Frame = +2 Query: 164 VCSSSGAGANSCLDTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 +C+++ G N + EWE LLKP+D++ L++S N ITP QLC++LELPLDV Sbjct: 26 LCTTTPLGKND---------DTEWENLLKPYDLKHLQRSLNPITPSQLCKLLELPLDV 74 >gb|EPS58828.1| hypothetical protein M569_15985, partial [Genlisea aurea] Length = 542 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +2 Query: 227 NEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 NEWE+LLKPFD E+L+K+ N ITP QL +L+LPLDV Sbjct: 1 NEWEKLLKPFDFEELRKTLNKITPSQLNMLLQLPLDV 37 >ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 711 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 224 ENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 ENEWE LLKPFD+ +L+KS ITP QL ++LELPLDV Sbjct: 39 ENEWERLLKPFDLNELRKSLIQITPIQLSKLLELPLDV 76 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 203 DTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 +T+ L EWE LLKPFD+ +L+ S ITP QLC++LELPLDV Sbjct: 65 NTNGLDSGTEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDV 109 >emb|CBI38482.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 203 DTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 +T+ L EWE LLKPFD+ +L+ S ITP QLC++LELPLDV Sbjct: 47 NTNGLDSGTEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDV 91 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 203 DTHRLGYENEWEELLKPFDIEDLKKSFNWITPRQLCQMLELPLDV 337 +T+ L EWE LLKPFD+ +L+ S ITP QLC++LELPLDV Sbjct: 47 NTNGLDSGTEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDV 91