BLASTX nr result
ID: Akebia26_contig00038466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00038466 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB77339.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 53 4e-10 gb|EXC16945.1| Cysteine-rich receptor-like protein kinase 25 [Mo... 55 1e-09 ref|XP_003637938.1| Cysteine-rich receptor-like protein kinase, ... 56 3e-09 ref|XP_007214635.1| hypothetical protein PRUPE_ppa001541mg [Prun... 64 2e-08 ref|XP_006383963.1| hypothetical protein POPTR_0004s02510g, part... 64 3e-08 ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [... 53 7e-08 ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, ... 53 7e-08 ref|XP_007025951.1| Cysteine-rich RLK 25 [Theobroma cacao] gi|50... 62 8e-08 ref|XP_006606027.1| PREDICTED: cysteine-rich receptor-like prote... 60 4e-07 gb|EXB50924.1| hypothetical protein L484_021151 [Morus notabilis] 50 2e-06 ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like prote... 57 3e-06 ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citr... 57 3e-06 ref|XP_006590220.1| PREDICTED: cysteine-rich receptor-like prote... 56 4e-06 ref|XP_004496791.1| PREDICTED: cysteine-rich receptor-like prote... 56 4e-06 ref|XP_006301588.1| hypothetical protein CARUB_v10022027mg [Caps... 56 4e-06 ref|XP_006383959.1| hypothetical protein POPTR_0004s02450g, part... 56 6e-06 ref|XP_007143168.1| hypothetical protein PHAVU_007G049400g [Phas... 55 8e-06 gb|AAD21872.1| receptor-like protein kinase homolog RK20-1 [Phas... 55 8e-06 ref|XP_002273323.2| PREDICTED: cysteine-rich receptor-like prote... 55 8e-06 emb|CBI39033.3| unnamed protein product [Vitis vinifera] 55 8e-06 >gb|EXB77339.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 731 Score = 53.1 bits (126), Expect(2) = 4e-10 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGK 101 Y LV+CTPDLS DC RCL A+ +P+CCSG+ Sbjct: 192 YSLVECTPDLSSMDCRRCLDTAIAELPNCCSGE 224 Score = 36.6 bits (83), Expect(2) = 4e-10 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +2 Query: 140 AKENPFPIIAVTVPSSIIAIVFLSTILVCYCSRKRRAK 253 +K + I+A+ VP++ IA++FL IL CYC RRAK Sbjct: 263 SKSSTLKIVAIVVPTAAIAVLFL--ILGCYCFAIRRAK 298 >gb|EXC16945.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis] Length = 631 Score = 54.7 bits (130), Expect(2) = 1e-09 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGK 101 Y LV+CTPDLS DC RCL A+ +P+CCSGK Sbjct: 190 YSLVECTPDLSSMDCRRCLDTAIAELPNCCSGK 222 Score = 33.1 bits (74), Expect(2) = 1e-09 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 140 AKENPFPIIAVTVPSSIIAIVFLSTILVCYCSRKRRAK 253 +K + +A+ VP++ IA++FL I CYC RRAK Sbjct: 261 SKSSTLKTVAIVVPTAAIAVLFL--IFGCYCFAIRRAK 296 >ref|XP_003637938.1| Cysteine-rich receptor-like protein kinase, partial [Medicago truncatula] gi|355503873|gb|AES85076.1| Cysteine-rich receptor-like protein kinase, partial [Medicago truncatula] Length = 538 Score = 55.8 bits (133), Expect(2) = 3e-09 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 YGLVQCTPDLSG DCN CL A+ IP CC+ K A ++ Sbjct: 177 YGLVQCTPDLSGQDCNDCLERAISDIPSCCNNKIGARII 215 Score = 30.8 bits (68), Expect(2) = 3e-09 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 164 IAVTVPSSIIAIVFLSTILVCYCSRKRRAK 253 IA+ VP+ ++ I +C C RKR+AK Sbjct: 255 IAIVVPTVVVVAAAALLIFICICLRKRKAK 284 >ref|XP_007214635.1| hypothetical protein PRUPE_ppa001541mg [Prunus persica] gi|462410500|gb|EMJ15834.1| hypothetical protein PRUPE_ppa001541mg [Prunus persica] Length = 805 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 Y LVQCTPDLSG DC+RCLR A+ L+P CC+GKP A V+ Sbjct: 195 YSLVQCTPDLSGTDCDRCLRGAIALLPACCNGKPGARVV 233 >ref|XP_006383963.1| hypothetical protein POPTR_0004s02510g, partial [Populus trichocarpa] gi|550340163|gb|ERP61760.1| hypothetical protein POPTR_0004s02510g, partial [Populus trichocarpa] Length = 505 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 Y L QCTPDLS DCNRCLR+A+ ++P CCS KP A +L Sbjct: 196 YSLAQCTPDLSSSDCNRCLRIAISILPSCCSQKPGASIL 234 >ref|XP_003637963.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355503898|gb|AES85101.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 671 Score = 52.8 bits (125), Expect(2) = 7e-08 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVLQ 122 YGLVQCTPDLS DCN CL A+ IP CC+ K VL+ Sbjct: 198 YGLVQCTPDLSEQDCNNCLDGAISDIPSCCNNKIGGRVLK 237 Score = 29.3 bits (64), Expect(2) = 7e-08 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 164 IAVTVPSSIIAIVFLSTILVCYCSRKRRAK 253 IA+ VP+ ++ + L I +C C RKR+A+ Sbjct: 276 IAIVVPTVVVVVAAL-LIFICICLRKRKAR 304 >ref|XP_003638011.1| Cysteine-rich receptor-like protein kinase, partial [Medicago truncatula] gi|355503946|gb|AES85149.1| Cysteine-rich receptor-like protein kinase, partial [Medicago truncatula] Length = 552 Score = 52.8 bits (125), Expect(2) = 7e-08 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVLQ 122 YGLVQCTPDLS DCN CL A+ IP CC+ K VL+ Sbjct: 198 YGLVQCTPDLSEQDCNNCLDGAISDIPSCCNNKIGGRVLK 237 Score = 29.3 bits (64), Expect(2) = 7e-08 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 164 IAVTVPSSIIAIVFLSTILVCYCSRKRRAK 253 IA+ VP+ ++ + L I +C C RKR+A+ Sbjct: 276 IAIVVPTVVVVVAAL-LIFICICLRKRKAR 304 >ref|XP_007025951.1| Cysteine-rich RLK 25 [Theobroma cacao] gi|508781317|gb|EOY28573.1| Cysteine-rich RLK 25 [Theobroma cacao] Length = 903 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVLQ 122 Y LVQCTPDLS DCN CLR A+ +PDCCSGK A VL+ Sbjct: 162 YSLVQCTPDLSSGDCNACLRGAIAALPDCCSGKQGARVLK 201 >ref|XP_006606027.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Glycine max] Length = 336 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 YGLVQCTP+LS FDCN C R A+ +P+CC GK A VL Sbjct: 208 YGLVQCTPELSLFDCNMCFRSAIASVPNCCDGKQGARVL 246 >gb|EXB50924.1| hypothetical protein L484_021151 [Morus notabilis] Length = 318 Score = 50.1 bits (118), Expect(2) = 2e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGK 101 Y LVQCTPDLS +C+RCL+ V L+P CC GK Sbjct: 191 YSLVQCTPDLSSSNCDRCLQGNVVLLPKCCVGK 223 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +2 Query: 161 IIAVTVPSSIIAIVFLSTILVCYCSRKRRAKE 256 I+A+ P S+ AI+FL I VCY +KR E Sbjct: 234 IVAICAPISV-AILFLIPIGVCYWLKKRSRDE 264 >ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Citrus sinensis] Length = 674 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 Y L QCTPDLS DCN CLR AV +P CCSGK VL Sbjct: 197 YSLAQCTPDLSSSDCNTCLRGAVARLPSCCSGKQGGRVL 235 >ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citrus clementina] gi|557551731|gb|ESR62360.1| hypothetical protein CICLE_v10014504mg [Citrus clementina] Length = 671 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/39 (64%), Positives = 26/39 (66%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 Y L QCTPDLS DCN CLR AV +P CCSGK VL Sbjct: 201 YSLAQCTPDLSSSDCNACLRGAVARLPSCCSGKQGGRVL 239 >ref|XP_006590220.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like [Glycine max] Length = 673 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVLQ 122 YGLVQCTPDLSG DC+ CL A+ I DCCSGK V++ Sbjct: 193 YGLVQCTPDLSGLDCSSCLVGAIENIQDCCSGKRGGRVIR 232 >ref|XP_004496791.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like [Cicer arietinum] Length = 307 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 YGLVQCTP+LS FDC CLR A+ +P+CC GK VL Sbjct: 190 YGLVQCTPELSLFDCIMCLRSAIASVPNCCDGKQGTRVL 228 >ref|XP_006301588.1| hypothetical protein CARUB_v10022027mg [Capsella rubella] gi|482570298|gb|EOA34486.1| hypothetical protein CARUB_v10022027mg [Capsella rubella] Length = 348 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMV 116 YGLVQCTPDL +DC RCL+ A DCC GK FA+V Sbjct: 196 YGLVQCTPDLDQYDCYRCLKSAYNETEDCCYGKRFALV 233 >ref|XP_006383959.1| hypothetical protein POPTR_0004s02450g, partial [Populus trichocarpa] gi|550340158|gb|ERP61756.1| hypothetical protein POPTR_0004s02450g, partial [Populus trichocarpa] Length = 280 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 Y L QCTPDLS FDCN+CL A+G +P CCS + VL Sbjct: 196 YSLAQCTPDLSSFDCNQCLSAAIGDLPFCCSSRTGGRVL 234 >ref|XP_007143168.1| hypothetical protein PHAVU_007G049400g [Phaseolus vulgaris] gi|561016358|gb|ESW15162.1| hypothetical protein PHAVU_007G049400g [Phaseolus vulgaris] Length = 672 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVLQ 122 YGLVQCTPDLS DCNRCL A+ IP CC K VL+ Sbjct: 196 YGLVQCTPDLSETDCNRCLDGAISEIPSCCGNKMGGRVLR 235 >gb|AAD21872.1| receptor-like protein kinase homolog RK20-1 [Phaseolus vulgaris] Length = 666 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/40 (62%), Positives = 27/40 (67%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVLQ 122 YGLVQCTPDLS DCNRCL A+ IP CC K VL+ Sbjct: 190 YGLVQCTPDLSETDCNRCLDGAISEIPSCCGNKMGGRVLR 229 >ref|XP_002273323.2| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Vitis vinifera] Length = 662 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 YGL QCTPDLSG DC RCL IP+CC GK A +L Sbjct: 195 YGLAQCTPDLSGSDCRRCLENIFSRIPNCCYGKQGARIL 233 >emb|CBI39033.3| unnamed protein product [Vitis vinifera] Length = 615 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +3 Query: 3 YGLVQCTPDLSGFDCNRCLRVAVGLIPDCCSGKPFAMVL 119 YGL QCTPDLSG DC RCL IP+CC GK A +L Sbjct: 195 YGLAQCTPDLSGSDCRRCLENIFSRIPNCCYGKQGARIL 233