BLASTX nr result
ID: Akebia26_contig00038321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00038321 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528353.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 >ref|XP_002528353.1| conserved hypothetical protein [Ricinus communis] gi|223532221|gb|EEF34025.1| conserved hypothetical protein [Ricinus communis] Length = 211 Score = 74.3 bits (181), Expect = 2e-11 Identities = 41/97 (42%), Positives = 55/97 (56%), Gaps = 1/97 (1%) Frame = +1 Query: 70 MYPRVKVRXXXXXXXXXKDQFVGKDER-DSLILLKVFDSLSLQEGCLPVKDYKSDSPPTV 246 MYP+VKVR D +V ++ SL+ LK L LQ+ C PVK+Y+ SP + Sbjct: 18 MYPKVKVRTEGQD-----DLYVAREHNWTSLLSLKDIQFLLLQDSCFPVKEYRDVSPVPI 72 Query: 247 ARIPKIYLPNFATPPNSLSKGVAANSKEIEDSKPNIR 357 A+IPK Y+PN P S S+GV S E+ +PNIR Sbjct: 73 AKIPKTYVPNILLPTESASEGVDNKSSSDEEDRPNIR 109