BLASTX nr result
ID: Akebia26_contig00038276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00038276 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445868.1| hypothetical protein CICLE_v10015308mg [Citr... 61 1e-07 ref|XP_006492736.1| PREDICTED: UPF0481 protein At3g47200-like [C... 61 2e-07 ref|XP_006420887.1| hypothetical protein CICLE_v10006434mg [Citr... 60 3e-07 gb|EXC31343.1| hypothetical protein L484_017623 [Morus notabilis] 60 4e-07 ref|XP_007034457.1| Uncharacterized protein isoform 1 [Theobroma... 60 4e-07 ref|XP_002303884.1| hypothetical protein POPTR_0003s22360g [Popu... 60 4e-07 ref|XP_006492737.1| PREDICTED: putative UPF0481 protein At3g0264... 59 5e-07 ref|XP_006445872.1| hypothetical protein CICLE_v10017831mg [Citr... 59 5e-07 ref|XP_006386114.1| hypothetical protein POPTR_0003s22390g [Popu... 59 5e-07 ref|XP_006420592.1| hypothetical protein CICLE_v10004970mg [Citr... 59 9e-07 ref|XP_002522138.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_006445879.1| hypothetical protein CICLE_v10015398mg [Citr... 58 1e-06 ref|XP_006446049.1| hypothetical protein CICLE_v10017796mg [Citr... 58 2e-06 ref|XP_002518141.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_002524913.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_006492738.1| PREDICTED: putative UPF0481 protein At3g0264... 57 2e-06 ref|XP_006445865.1| hypothetical protein CICLE_v10015107mg [Citr... 57 2e-06 ref|XP_006386037.1| hypothetical protein POPTR_0003s20630g [Popu... 57 2e-06 ref|XP_006489812.1| PREDICTED: UPF0481 protein At3g47200-like [C... 57 3e-06 ref|XP_006487609.1| PREDICTED: UPF0481 protein At3g47200-like [C... 57 3e-06 >ref|XP_006445868.1| hypothetical protein CICLE_v10015308mg [Citrus clementina] gi|557548479|gb|ESR59108.1| hypothetical protein CICLE_v10015308mg [Citrus clementina] Length = 431 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I V EL + G+ F++G S NLLDIKFN +G+LEIP L + D TER++RN++A Sbjct: 258 IPSVKELHQAGVKFKRGSSKNLLDIKFN--EGILEIPFLTVYDSTERLYRNVLA 309 >ref|XP_006492736.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis] Length = 340 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/64 (50%), Positives = 40/64 (62%) Frame = -1 Query: 194 PTDSDSYSDFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFR 15 P DS I V EL + G+ F G S NLLDIKFN +G+LEIP L + D TE ++R Sbjct: 157 PADSALNDRNIPSVKELHQAGVKFEPGSSKNLLDIKFN--EGILEIPFLTVYDSTEHLYR 214 Query: 14 NLIA 3 NL+A Sbjct: 215 NLLA 218 >ref|XP_006420887.1| hypothetical protein CICLE_v10006434mg [Citrus clementina] gi|557522760|gb|ESR34127.1| hypothetical protein CICLE_v10006434mg [Citrus clementina] Length = 429 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -1 Query: 170 DFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNL 9 +FI C T L+ GI F K E +LL I F+ G+L+IPTL I+DDTE FRN+ Sbjct: 247 NFIVCATNLKEAGIKFEKIEGESLLSIDFDKDAGILKIPTLTIDDDTESFFRNI 300 >gb|EXC31343.1| hypothetical protein L484_017623 [Morus notabilis] Length = 453 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 3/66 (4%) Frame = -1 Query: 191 TDSDSYS---DFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERI 21 T+SD+ S + ++ T L GI F+ S ++LDIKF+ K GVLEIPTL I++ TE + Sbjct: 266 TNSDTISCELEPMRSATSLEESGIKFKMCASKSILDIKFHEKQGVLEIPTLFIQETTETV 325 Query: 20 FRNLIA 3 FRNLI+ Sbjct: 326 FRNLIS 331 >ref|XP_007034457.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590657079|ref|XP_007034458.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508713486|gb|EOY05383.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508713487|gb|EOY05384.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 418 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = -1 Query: 167 FIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 F+ C TEL+ GI F+K E ++ DIKF ++G ++IPTL I+DDTE RN+IA Sbjct: 239 FMHCATELKEAGIRFKKVEGRSIFDIKF--ENGTMKIPTLEIDDDTEWFLRNVIA 291 >ref|XP_002303884.1| hypothetical protein POPTR_0003s22360g [Populus trichocarpa] gi|222841316|gb|EEE78863.1| hypothetical protein POPTR_0003s22360g [Populus trichocarpa] Length = 462 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -1 Query: 155 VTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 V EL R GI F+ G S NLLDIKF+ +G LEIP LRI TE +FRNL A Sbjct: 264 VAELHRAGIKFKLGSSKNLLDIKFDDNEGTLEIPQLRIGKRTEILFRNLQA 314 >ref|XP_006492737.1| PREDICTED: putative UPF0481 protein At3g02645-like [Citrus sinensis] Length = 389 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I V +L + GI F++G S +LLDIKFN +G+LEIP LR+++ TER++RN++A Sbjct: 211 IPSVKKLDQAGIKFKRGSSKDLLDIKFN--EGILEIPFLRVDETTERLYRNVLA 262 >ref|XP_006445872.1| hypothetical protein CICLE_v10017831mg [Citrus clementina] gi|557548483|gb|ESR59112.1| hypothetical protein CICLE_v10017831mg [Citrus clementina] Length = 364 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/54 (51%), Positives = 42/54 (77%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I V +L + GI F++G S +LLDIKFN +G+LEIP LR+++ TER++RN++A Sbjct: 186 IPSVKKLDQAGIKFKRGSSKDLLDIKFN--EGILEIPFLRVDETTERLYRNVLA 237 >ref|XP_006386114.1| hypothetical protein POPTR_0003s22390g [Populus trichocarpa] gi|550343780|gb|ERP63911.1| hypothetical protein POPTR_0003s22390g [Populus trichocarpa] Length = 439 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 + V EL R GI F+ G S NLL IKF+ +G LEIP LRI D TE +FRNL A Sbjct: 260 VPSVAELHRAGIKFKLGSSINLLHIKFDDNEGTLEIPQLRILDHTEILFRNLQA 313 >ref|XP_006420592.1| hypothetical protein CICLE_v10004970mg [Citrus clementina] gi|557522465|gb|ESR33832.1| hypothetical protein CICLE_v10004970mg [Citrus clementina] Length = 444 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/62 (46%), Positives = 40/62 (64%) Frame = -1 Query: 194 PTDSDSYSDFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFR 15 P D+++ FI C T L+ GI F K E +LL I+F+ G+L+IP L I+DDTE FR Sbjct: 266 PARKDNWN-FIVCATNLKEAGIKFEKIEGGSLLSIEFDKDAGILKIPRLTIDDDTESFFR 324 Query: 14 NL 9 N+ Sbjct: 325 NI 326 >ref|XP_002522138.1| conserved hypothetical protein [Ricinus communis] gi|223538737|gb|EEF40338.1| conserved hypothetical protein [Ricinus communis] Length = 417 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I CVTEL + G+ F GE+HNL++I F K+GVL IP +R+ D+ E + RNLIA Sbjct: 244 IPCVTELLQAGVDFAVGETHNLMNITF--KNGVLTIPPVRVLDNAESLLRNLIA 295 >ref|XP_006445879.1| hypothetical protein CICLE_v10015398mg [Citrus clementina] gi|557548490|gb|ESR59119.1| hypothetical protein CICLE_v10015398mg [Citrus clementina] Length = 415 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I V EL + G+ F+ G S+NLLDIKFN +G+LEIP L + TER++RN++A Sbjct: 242 IPSVKELHQAGVKFKPGSSNNLLDIKFN--EGILEIPFLTVYGSTERLYRNVLA 293 >ref|XP_006446049.1| hypothetical protein CICLE_v10017796mg [Citrus clementina] gi|557548660|gb|ESR59289.1| hypothetical protein CICLE_v10017796mg [Citrus clementina] Length = 427 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -1 Query: 155 VTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 V EL + G+ F+ G S NLLDIKF K+G+LEIP L + D TER +RNL+A Sbjct: 257 VKELEQSGVQFKLGSSKNLLDIKF--KNGILEIPFLTVTDMTERFYRNLLA 305 >ref|XP_002518141.1| conserved hypothetical protein [Ricinus communis] gi|223542737|gb|EEF44274.1| conserved hypothetical protein [Ricinus communis] Length = 422 Score = 57.8 bits (138), Expect = 2e-06 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 8/72 (11%) Frame = -1 Query: 194 PTDSDSYSD--------FIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIE 39 PT +SY + F +C EL+ GI F+K E NL DI F ++GV+ IPTL I Sbjct: 227 PTRMESYLNMRENVKRSFPRCAIELQEAGIKFKKVEEQNLFDISF--RNGVMRIPTLTIR 284 Query: 38 DDTERIFRNLIA 3 D+T+ I RNLIA Sbjct: 285 DETQCIMRNLIA 296 >ref|XP_002524913.1| conserved hypothetical protein [Ricinus communis] gi|223535748|gb|EEF37410.1| conserved hypothetical protein [Ricinus communis] Length = 531 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = -1 Query: 173 SDFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 + I CVTELR GI F+K ++ DIKF KDGVL IP L + D T+ +F NLIA Sbjct: 347 TQLIHCVTELREAGIKFKKRKTDRFWDIKF--KDGVLRIPRLLVHDGTKSLFLNLIA 401 >ref|XP_006492738.1| PREDICTED: putative UPF0481 protein At3g02645-like, partial [Citrus sinensis] Length = 311 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I V EL + G+ F+ G S NLLDIKFN +G+LEIP L + TER++RN++A Sbjct: 258 IPSVKELHQAGVKFKPGSSKNLLDIKFN--EGILEIPFLTVYGSTERLYRNVLA 309 >ref|XP_006445865.1| hypothetical protein CICLE_v10015107mg [Citrus clementina] gi|557548476|gb|ESR59105.1| hypothetical protein CICLE_v10015107mg [Citrus clementina] Length = 474 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = -1 Query: 164 IQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 I V EL + G+ F+ G S NLLDIKFN +G+LEIP L + TER++RN++A Sbjct: 301 IPIVKELHQAGVKFKPGSSKNLLDIKFN--EGILEIPFLTVYGSTERLYRNVLA 352 >ref|XP_006386037.1| hypothetical protein POPTR_0003s20630g [Populus trichocarpa] gi|550343643|gb|ERP63834.1| hypothetical protein POPTR_0003s20630g [Populus trichocarpa] Length = 436 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -1 Query: 155 VTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNLIA 3 V ELRR GI F+ G S NLL IKF+ +G LEIP +I D TE +FRNL A Sbjct: 260 VAELRRAGIKFKLGPSINLLHIKFDDNEGTLEIPHFKIFDHTEILFRNLQA 310 >ref|XP_006489812.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis] Length = 592 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -1 Query: 170 DFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNL 9 +FI T LR GI F K E +LL I F+ G+L+IPTL I+DDTE FRN+ Sbjct: 410 NFIISATNLREAGIKFEKIEGESLLSIDFDKDAGILKIPTLTIDDDTESFFRNI 463 >ref|XP_006487609.1| PREDICTED: UPF0481 protein At3g47200-like [Citrus sinensis] Length = 437 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/54 (51%), Positives = 35/54 (64%) Frame = -1 Query: 170 DFIQCVTELRRGGITFRKGESHNLLDIKFNPKDGVLEIPTLRIEDDTERIFRNL 9 +FI T LR GI F K E +LL I F+ G+L+IPTL I+DDTE FRN+ Sbjct: 255 NFIISATNLREAGIKFEKIEGESLLSIDFDKDAGILKIPTLTIDDDTESFFRNI 308