BLASTX nr result
ID: Akebia26_contig00036424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00036424 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001233920.1| sucrose-phosphate synthase [Solanum lycopers... 55 8e-06 gb|AAC24872.3| sucrose-phosphate synthase [Solanum lycopersicum] 55 8e-06 gb|ABC96184.1| sucrose phosphate synthase [Cucumis melo] 55 8e-06 gb|ABF47344.1| sucrose phosphate synthase [Cucumis melo] 55 8e-06 ref|NP_001234839.1| sucrose phosphate synthase [Solanum lycopers... 55 8e-06 >ref|NP_001233920.1| sucrose-phosphate synthase [Solanum lycopersicum] gi|11231164|dbj|BAB18136.1| sucrose-phosphate synthase [Solanum lycopersicum] Length = 1053 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 4/36 (11%) Frame = +2 Query: 209 KVNLSCYNY----LQIIPPGMEFHHIVPHDGDMDGD 304 K N+SCY + +IPPGMEFHHIVPH+GDMDGD Sbjct: 412 KRNVSCYGRFMPRMAVIPPGMEFHHIVPHEGDMDGD 447 >gb|AAC24872.3| sucrose-phosphate synthase [Solanum lycopersicum] Length = 1050 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 4/36 (11%) Frame = +2 Query: 209 KVNLSCYNY----LQIIPPGMEFHHIVPHDGDMDGD 304 K N+SCY + +IPPGMEFHHIVPH+GDMDGD Sbjct: 409 KRNVSCYGRFMPRMAVIPPGMEFHHIVPHEGDMDGD 444 >gb|ABC96184.1| sucrose phosphate synthase [Cucumis melo] Length = 1054 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 4/36 (11%) Frame = +2 Query: 209 KVNLSCYNY----LQIIPPGMEFHHIVPHDGDMDGD 304 K N+SCY + +IPPGMEFHHIVPH+GDMDGD Sbjct: 412 KRNVSCYGRFMPRMAVIPPGMEFHHIVPHEGDMDGD 447 >gb|ABF47344.1| sucrose phosphate synthase [Cucumis melo] Length = 1054 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 4/36 (11%) Frame = +2 Query: 209 KVNLSCYNY----LQIIPPGMEFHHIVPHDGDMDGD 304 K N+SCY + +IPPGMEFHHIVPH+GDMDGD Sbjct: 412 KRNVSCYGRFMPRMAVIPPGMEFHHIVPHEGDMDGD 447 >ref|NP_001234839.1| sucrose phosphate synthase [Solanum lycopersicum] gi|52139814|gb|AAU29197.1| sucrose phosphate synthase [Solanum lycopersicum] Length = 1054 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 4/36 (11%) Frame = +2 Query: 209 KVNLSCYNY----LQIIPPGMEFHHIVPHDGDMDGD 304 K N+SCY + +IPPGMEFHHIVPH+GDMDGD Sbjct: 412 KRNVSCYGRFMPRMAVIPPGMEFHHIVPHEGDMDGD 447