BLASTX nr result
ID: Akebia26_contig00036400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00036400 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37016.1| hypothetical protein MIMGU_mgv1a0078932mg, partia... 62 1e-07 ref|XP_006409806.1| hypothetical protein EUTSA_v10016630mg [Eutr... 60 4e-07 ref|NP_001031434.1| serine carboxypeptidase-like 51 [Arabidopsis... 60 4e-07 ref|NP_973551.1| serine carboxypeptidase-like 51 [Arabidopsis th... 60 4e-07 ref|NP_565663.1| serine carboxypeptidase-like 51 [Arabidopsis th... 60 4e-07 dbj|BAD43689.1| putative carboxypeptidase [Arabidopsis thaliana] 60 4e-07 dbj|BAD44348.1| putative carboxypeptidase [Arabidopsis thaliana] 60 4e-07 ref|XP_002879131.1| SCPL51 [Arabidopsis lyrata subsp. lyrata] gi... 60 4e-07 gb|ABK95846.1| unknown [Populus trichocarpa] 59 5e-07 ref|XP_007205236.1| hypothetical protein PRUPE_ppa006094mg [Prun... 59 7e-07 emb|CBI17117.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002273519.1| PREDICTED: serine carboxypeptidase-like 51-l... 59 7e-07 ref|XP_002523746.1| retinoid-inducible serine carboxypeptidase, ... 59 7e-07 emb|CAN75395.1| hypothetical protein VITISV_004140 [Vitis vinifera] 59 7e-07 gb|EMS47341.1| Serine carboxypeptidase-like 51 [Triticum urartu] 59 9e-07 ref|XP_004984136.1| PREDICTED: serine carboxypeptidase-like 51-l... 58 1e-06 dbj|BAJ96492.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 dbj|BAJ85248.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 gb|AAS79599.1| putative serine carboxipeptidase [Ipomoea trifida] 58 1e-06 ref|XP_006295521.1| hypothetical protein CARUB_v10024625mg [Caps... 58 2e-06 >gb|EYU37016.1| hypothetical protein MIMGU_mgv1a0078932mg, partial [Mimulus guttatus] Length = 86 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPCVAL MIG IT+SPI+S Sbjct: 55 WILGAGHFVPVDQPCVALNMIGSITQSPITS 85 >ref|XP_006409806.1| hypothetical protein EUTSA_v10016630mg [Eutrema salsugineum] gi|557110975|gb|ESQ51259.1| hypothetical protein EUTSA_v10016630mg [Eutrema salsugineum] Length = 458 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 429 WILGAGHFVPVDEPCVALKMVGEITKSP 456 >ref|NP_001031434.1| serine carboxypeptidase-like 51 [Arabidopsis thaliana] gi|330252966|gb|AEC08060.1| serine carboxypeptidase-like 51 [Arabidopsis thaliana] Length = 394 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 365 WILGAGHFVPVDEPCVALKMVGEITKSP 392 >ref|NP_973551.1| serine carboxypeptidase-like 51 [Arabidopsis thaliana] gi|330252964|gb|AEC08058.1| serine carboxypeptidase-like 51 [Arabidopsis thaliana] Length = 389 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 360 WILGAGHFVPVDEPCVALKMVGEITKSP 387 >ref|NP_565663.1| serine carboxypeptidase-like 51 [Arabidopsis thaliana] gi|125987784|sp|Q67Y83.2|SCP51_ARATH RecName: Full=Serine carboxypeptidase-like 51; Flags: Precursor gi|15724218|gb|AAL06502.1|AF412049_1 At2g27920/T1E2.16 [Arabidopsis thaliana] gi|20197951|gb|AAD21510.2| putative carboxypeptidase [Arabidopsis thaliana] gi|27764970|gb|AAO23606.1| At2g27920/T1E2.16 [Arabidopsis thaliana] gi|330252965|gb|AEC08059.1| serine carboxypeptidase-like 51 [Arabidopsis thaliana] Length = 461 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 432 WILGAGHFVPVDEPCVALKMVGEITKSP 459 >dbj|BAD43689.1| putative carboxypeptidase [Arabidopsis thaliana] Length = 268 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 239 WILGAGHFVPVDEPCVALKMVGEITKSP 266 >dbj|BAD44348.1| putative carboxypeptidase [Arabidopsis thaliana] Length = 394 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 365 WILGAGHFVPVDEPCVALKMVGEITKSP 392 >ref|XP_002879131.1| SCPL51 [Arabidopsis lyrata subsp. lyrata] gi|297324970|gb|EFH55390.1| SCPL51 [Arabidopsis lyrata subsp. lyrata] Length = 462 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVALKM+G+IT+SP Sbjct: 433 WILGAGHFVPVDEPCVALKMVGEITKSP 460 >gb|ABK95846.1| unknown [Populus trichocarpa] Length = 188 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVDQPC+ALKM+G IT+SP Sbjct: 139 WILGAGHFVPVDQPCIALKMVGQITQSP 166 >ref|XP_007205236.1| hypothetical protein PRUPE_ppa006094mg [Prunus persica] gi|462400878|gb|EMJ06435.1| hypothetical protein PRUPE_ppa006094mg [Prunus persica] Length = 427 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC+AL M+ DIT+SP +S Sbjct: 386 WILGAGHFVPVDQPCIALNMVADITQSPAAS 416 >emb|CBI17117.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC+AL M+G IT SP++S Sbjct: 404 WILGAGHFVPVDQPCIALNMVGGITHSPMAS 434 >ref|XP_002273519.1| PREDICTED: serine carboxypeptidase-like 51-like [Vitis vinifera] Length = 465 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC+AL M+G IT SP++S Sbjct: 433 WILGAGHFVPVDQPCIALNMVGGITHSPMAS 463 >ref|XP_002523746.1| retinoid-inducible serine carboxypeptidase, putative [Ricinus communis] gi|223537050|gb|EEF38686.1| retinoid-inducible serine carboxypeptidase, putative [Ricinus communis] Length = 459 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC++LKM+G IT+SP S+ Sbjct: 429 WILGAGHFVPVDQPCISLKMVGAITQSPAST 459 >emb|CAN75395.1| hypothetical protein VITISV_004140 [Vitis vinifera] Length = 458 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC+AL M+G IT SP++S Sbjct: 426 WILGAGHFVPVDQPCIALNMVGGITHSPMAS 456 >gb|EMS47341.1| Serine carboxypeptidase-like 51 [Triticum urartu] Length = 450 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPCVAL MIG+IT+SP S Sbjct: 418 WILGAGHFVPVDQPCVALDMIGNITQSPALS 448 >ref|XP_004984136.1| PREDICTED: serine carboxypeptidase-like 51-like [Setaria italica] Length = 454 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPIS 90 WILGAGH+VPVDQPC+AL MIG+IT+SP S Sbjct: 425 WILGAGHYVPVDQPCIALSMIGNITQSPAS 454 >dbj|BAJ96492.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 476 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC+AL MIG+IT+SP S Sbjct: 444 WILGAGHFVPVDQPCIALDMIGNITQSPALS 474 >dbj|BAJ85248.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 438 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPC+AL MIG+IT+SP S Sbjct: 406 WILGAGHFVPVDQPCIALDMIGNITQSPALS 436 >gb|AAS79599.1| putative serine carboxipeptidase [Ipomoea trifida] Length = 492 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSPISS 93 WILGAGHFVPVDQPCV+L M+G+IT+SP +S Sbjct: 461 WILGAGHFVPVDQPCVSLDMVGNITQSPATS 491 >ref|XP_006295521.1| hypothetical protein CARUB_v10024625mg [Capsella rubella] gi|482564229|gb|EOA28419.1| hypothetical protein CARUB_v10024625mg [Capsella rubella] Length = 465 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +1 Query: 1 WILGAGHFVPVDQPCVALKMIGDITRSP 84 WILGAGHFVPVD+PCVAL M+G+IT+SP Sbjct: 436 WILGAGHFVPVDEPCVALNMVGEITKSP 463